Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | A1R12_RS11665 | Genome accession | NZ_CP014783 |
| Coordinates | 2479964..2480137 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus amyloliquefaciens strain B15 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2474964..2485137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A1R12_RS11650 (A1R12_11650) | gcvT | 2475777..2476877 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| A1R12_RS11655 (A1R12_11655) | - | 2477301..2478971 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| A1R12_RS11660 (A1R12_11660) | - | 2478993..2479787 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| A1R12_RS11665 (A1R12_11665) | sinI | 2479964..2480137 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| A1R12_RS11670 (A1R12_11670) | sinR | 2480171..2480506 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| A1R12_RS11675 (A1R12_11675) | tasA | 2480554..2481339 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| A1R12_RS11680 (A1R12_11680) | sipW | 2481404..2481988 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| A1R12_RS11685 (A1R12_11685) | tapA | 2481960..2482631 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| A1R12_RS11690 (A1R12_11690) | - | 2482890..2483219 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| A1R12_RS11695 (A1R12_11695) | - | 2483260..2483439 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| A1R12_RS11700 (A1R12_11700) | comGG | 2483496..2483873 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| A1R12_RS11705 (A1R12_11705) | comGF | 2483874..2484374 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| A1R12_RS11710 (A1R12_11710) | comGE | 2484283..2484597 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| A1R12_RS11715 (A1R12_11715) | comGD | 2484581..2485018 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=173975 A1R12_RS11665 WP_014418369.1 2479964..2480137(+) (sinI) [Bacillus amyloliquefaciens strain B15]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=173975 A1R12_RS11665 WP_014418369.1 2479964..2480137(+) (sinI) [Bacillus amyloliquefaciens strain B15]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |