Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AB684_RS13530 Genome accession   NZ_CP014781
Coordinates   2624018..2624194 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain HRBL-15TDI7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2619018..2629194
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB684_RS13515 (AB684_13515) gcvT 2619660..2620754 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  AB684_RS13520 (AB684_13520) - 2621347..2623026 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  AB684_RS13525 (AB684_13525) - 2623033..2623827 (+) 795 WP_003183441.1 YqhG family protein -
  AB684_RS13530 (AB684_13530) sinI 2624018..2624194 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  AB684_RS13535 (AB684_13535) sinR 2624228..2624563 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  AB684_RS13540 (AB684_13540) tasA 2624668..2625462 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  AB684_RS13545 (AB684_13545) sipW 2625536..2626120 (-) 585 WP_003183449.1 signal peptidase I SipW -
  AB684_RS13550 (AB684_13550) tapA 2626117..2626845 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  AB684_RS13555 (AB684_13555) - 2627122..2627442 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  AB684_RS13560 (AB684_13560) - 2627466..2627648 (-) 183 WP_003183456.1 YqzE family protein -
  AB684_RS13565 (AB684_13565) comGG 2627737..2628102 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  AB684_RS13570 (AB684_13570) comGF 2628115..2628495 (-) 381 WP_016885935.1 competence type IV pilus minor pilin ComGF -
  AB684_RS13575 (AB684_13575) comGE 2628512..2628859 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=173879 AB684_RS13530 WP_003183444.1 2624018..2624194(+) (sinI) [Bacillus licheniformis strain HRBL-15TDI7]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=173879 AB684_RS13530 WP_003183444.1 2624018..2624194(+) (sinI) [Bacillus licheniformis strain HRBL-15TDI7]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment