Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   BSR19_RS09720 Genome accession   NZ_CP018187
Coordinates   2106856..2107086 (-) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain ICDC2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2101856..2112086
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR19_RS09685 (BSR19_09815) - 2102246..2102692 (-) 447 WP_013991259.1 hypothetical protein -
  BSR19_RS09690 (BSR19_09820) - 2102770..2103426 (-) 657 WP_037601483.1 CPBP family intramembrane glutamic endopeptidase -
  BSR19_RS09695 (BSR19_09825) - 2103438..2103635 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  BSR19_RS09700 (BSR19_09830) - 2103886..2105079 (-) 1194 WP_138261572.1 acetate kinase -
  BSR19_RS09705 (BSR19_09835) comGH 2105136..2106092 (-) 957 WP_138261573.1 class I SAM-dependent methyltransferase Machinery gene
  BSR19_RS09710 (BSR19_09840) comGG 2106137..2106454 (-) 318 WP_156247046.1 competence type IV pilus minor pilin ComGG Machinery gene
  BSR19_RS09715 (BSR19_09845) comGF 2106432..2106869 (-) 438 WP_045769383.1 competence type IV pilus minor pilin ComGF Machinery gene
  BSR19_RS09720 (BSR19_09850) comGE 2106856..2107086 (-) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  BSR19_RS09725 (BSR19_09855) comGD 2107118..2107546 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  BSR19_RS09730 (BSR19_09860) comGC 2107506..2107832 (-) 327 WP_002885815.1 competence type IV pilus major pilin ComGC Machinery gene
  BSR19_RS09735 (BSR19_09865) comGB 2107829..2108929 (-) 1101 WP_156247047.1 competence type IV pilus assembly protein ComGB Machinery gene
  BSR19_RS09740 (BSR19_09870) comGA 2108811..2109752 (-) 942 WP_002885658.1 competence type IV pilus ATPase ComGA Machinery gene
  BSR19_RS09745 (BSR19_09875) - 2109834..2110196 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=173676 BSR19_RS09720 WP_002887015.1 2106856..2107086(-) (comGE) [Streptococcus salivarius strain ICDC2]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=173676 BSR19_RS09720 WP_002887015.1 2106856..2107086(-) (comGE) [Streptococcus salivarius strain ICDC2]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCAGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382


Multiple sequence alignment