Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AWM80_RS12295 | Genome accession | NZ_CP014166 |
| Coordinates | 2393155..2393328 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain CU1050 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2388155..2398328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AWM80_RS12280 (AWM80_12285) | gcvT | 2388954..2390042 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AWM80_RS12285 (AWM80_12290) | hepAA | 2390484..2392157 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| AWM80_RS12290 (AWM80_12295) | yqhG | 2392178..2392972 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| AWM80_RS12295 (AWM80_12300) | sinI | 2393155..2393328 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| AWM80_RS12300 (AWM80_12305) | sinR | 2393362..2393697 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AWM80_RS12305 (AWM80_12310) | tasA | 2393790..2394575 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| AWM80_RS12310 (AWM80_12315) | sipW | 2394639..2395211 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| AWM80_RS12315 (AWM80_12320) | tapA | 2395195..2395956 (-) | 762 | Protein_2355 | amyloid fiber anchoring/assembly protein TapA | - |
| AWM80_RS12320 (AWM80_12325) | yqzG | 2396228..2396554 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| AWM80_RS12325 (AWM80_12330) | spoIITA | 2396596..2396775 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| AWM80_RS12330 (AWM80_12335) | comGG | 2396846..2397220 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| AWM80_RS12335 (AWM80_12340) | comGF | 2397221..2397604 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| AWM80_RS12340 (AWM80_12345) | comGE | 2397630..2397977 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=169128 AWM80_RS12295 WP_003230187.1 2393155..2393328(+) (sinI) [Bacillus subtilis subsp. subtilis strain CU1050]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=169128 AWM80_RS12295 WP_003230187.1 2393155..2393328(+) (sinI) [Bacillus subtilis subsp. subtilis strain CU1050]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |