Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AWM80_RS12295 Genome accession   NZ_CP014166
Coordinates   2393155..2393328 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain CU1050     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2388155..2398328
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWM80_RS12280 (AWM80_12285) gcvT 2388954..2390042 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  AWM80_RS12285 (AWM80_12290) hepAA 2390484..2392157 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  AWM80_RS12290 (AWM80_12295) yqhG 2392178..2392972 (+) 795 WP_003230200.1 YqhG family protein -
  AWM80_RS12295 (AWM80_12300) sinI 2393155..2393328 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AWM80_RS12300 (AWM80_12305) sinR 2393362..2393697 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AWM80_RS12305 (AWM80_12310) tasA 2393790..2394575 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  AWM80_RS12310 (AWM80_12315) sipW 2394639..2395211 (-) 573 WP_003246088.1 signal peptidase I SipW -
  AWM80_RS12315 (AWM80_12320) tapA 2395195..2395956 (-) 762 Protein_2355 amyloid fiber anchoring/assembly protein TapA -
  AWM80_RS12320 (AWM80_12325) yqzG 2396228..2396554 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AWM80_RS12325 (AWM80_12330) spoIITA 2396596..2396775 (-) 180 WP_003230176.1 YqzE family protein -
  AWM80_RS12330 (AWM80_12335) comGG 2396846..2397220 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AWM80_RS12335 (AWM80_12340) comGF 2397221..2397604 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AWM80_RS12340 (AWM80_12345) comGE 2397630..2397977 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=169128 AWM80_RS12295 WP_003230187.1 2393155..2393328(+) (sinI) [Bacillus subtilis subsp. subtilis strain CU1050]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=169128 AWM80_RS12295 WP_003230187.1 2393155..2393328(+) (sinI) [Bacillus subtilis subsp. subtilis strain CU1050]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment