Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BL1202_RS17795 Genome accession   NZ_CP017247
Coordinates   3410607..3410747 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   A0ABM6LMF9
Organism   Bacillus licheniformis strain BL1202     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3405607..3415747
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BL1202_RS17770 (BL1202_03635) - 3405904..3406293 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  BL1202_RS17775 (BL1202_03636) comA 3406310..3406948 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  BL1202_RS17780 (BL1202_03637) comP 3407035..3409341 (-) 2307 WP_003184851.1 ATP-binding protein Regulator
  BL1202_RS17785 (BL1202_03638) comX 3409364..3409528 (-) 165 WP_003184853.1 competence pheromone ComX -
  BL1202_RS17790 (BL1202_03639) comQ 3409537..3410418 (-) 882 WP_021837675.1 polyprenyl synthetase family protein Regulator
  BL1202_RS17795 (BL1202_03640) degQ 3410607..3410747 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  BL1202_RS17805 (BL1202_03642) - 3411233..3411580 (+) 348 WP_231105863.1 SDR family oxidoreductase -
  BL1202_RS17810 (BL1202_03643) - 3411623..3412843 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  BL1202_RS17815 (BL1202_03644) - 3413022..3414491 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  BL1202_RS17820 (BL1202_03645) - 3414509..3415060 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  BL1202_RS17825 (BL1202_03646) - 3415245..3415646 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=167266 BL1202_RS17795 WP_003184860.1 3410607..3410747(-) (degQ) [Bacillus licheniformis strain BL1202]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=167266 BL1202_RS17795 WP_003184860.1 3410607..3410747(-) (degQ) [Bacillus licheniformis strain BL1202]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains

Predicted by InterProScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652