Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   BL1202_RS13950 Genome accession   NZ_CP017247
Coordinates   2685700..2686137 (-) Length   145 a.a.
NCBI ID   WP_026699159.1    Uniprot ID   -
Organism   Bacillus licheniformis strain BL1202     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2680700..2691137
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BL1202_RS13900 (BL1202_02846) sinI 2680869..2681045 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  BL1202_RS13905 (BL1202_02847) sinR 2681079..2681414 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  BL1202_RS13910 (BL1202_02848) tasA 2681519..2682313 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  BL1202_RS13915 (BL1202_02849) sipW 2682387..2682971 (-) 585 WP_003183449.1 signal peptidase I SipW -
  BL1202_RS13920 (BL1202_02850) tapA 2682968..2683696 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  BL1202_RS13925 (BL1202_02851) - 2683973..2684293 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  BL1202_RS13930 (BL1202_02852) - 2684323..2684505 (-) 183 WP_003183456.1 YqzE family protein -
  BL1202_RS13935 (BL1202_02853) comGG 2684594..2684959 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  BL1202_RS13940 (BL1202_02854) comGF 2684972..2685460 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  BL1202_RS13945 comGE 2685369..2685716 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -
  BL1202_RS13950 (BL1202_02855) comGD 2685700..2686137 (-) 438 WP_026699159.1 competence type IV pilus minor pilin ComGD Machinery gene
  BL1202_RS13955 (BL1202_02856) comGC 2686143..2686436 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  BL1202_RS13960 (BL1202_02857) comGB 2686450..2687484 (-) 1035 WP_026699158.1 competence type IV pilus assembly protein ComGB Machinery gene
  BL1202_RS13965 (BL1202_02858) comGA 2687474..2688538 (-) 1065 WP_069500612.1 competence type IV pilus ATPase ComGA Machinery gene
  BL1202_RS13970 (BL1202_02859) - 2688695..2689534 (-) 840 WP_003183480.1 STAS domain-containing protein -
  BL1202_RS13980 (BL1202_02861) - 2689776..2690153 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  BL1202_RS13985 (BL1202_02862) - 2690362..2690607 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16275.10 Da        Isoelectric Point: 9.6134

>NTDB_id=167239 BL1202_RS13950 WP_026699159.1 2685700..2686137(-) (comGD) [Bacillus licheniformis strain BL1202]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKYSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=167239 BL1202_RS13950 WP_026699159.1 2685700..2686137(-) (comGD) [Bacillus licheniformis strain BL1202]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGTATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393