Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AUL54_RS18365 | Genome accession | NZ_CP013950 |
| Coordinates | 3732099..3732272 (-) | Length | 57 a.a. |
| NCBI ID | WP_016938977.1 | Uniprot ID | - |
| Organism | Bacillus sp. SDLI1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3727099..3737272
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUL54_RS18315 (AUL54_18325) | comGD | 3727219..3727656 (+) | 438 | WP_060964765.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AUL54_RS18320 (AUL54_18330) | comGE | 3727640..3727954 (+) | 315 | WP_060964766.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AUL54_RS18325 (AUL54_18335) | comGF | 3727866..3728363 (+) | 498 | WP_235588382.1 | competence type IV pilus minor pilin ComGF | - |
| AUL54_RS18330 (AUL54_18340) | comGG | 3728364..3728741 (+) | 378 | WP_060964768.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AUL54_RS18335 (AUL54_18345) | - | 3728798..3728977 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| AUL54_RS18340 (AUL54_18350) | - | 3729018..3729347 (-) | 330 | WP_016938972.1 | DUF3889 domain-containing protein | - |
| AUL54_RS18345 (AUL54_18355) | tapA | 3729606..3730277 (+) | 672 | WP_060964769.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AUL54_RS18350 (AUL54_18360) | - | 3730249..3730833 (+) | 585 | WP_060964770.1 | signal peptidase I | - |
| AUL54_RS18355 (AUL54_18365) | - | 3730897..3731682 (+) | 786 | WP_016938976.1 | TasA family protein | - |
| AUL54_RS18360 (AUL54_18370) | sinR | 3731730..3732065 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AUL54_RS18365 (AUL54_18375) | sinI | 3732099..3732272 (-) | 174 | WP_016938977.1 | anti-repressor SinI family protein | Regulator |
| AUL54_RS18370 (AUL54_18380) | - | 3732449..3733243 (-) | 795 | WP_060964771.1 | YqhG family protein | - |
| AUL54_RS18375 (AUL54_18385) | - | 3733265..3734935 (-) | 1671 | WP_060964772.1 | SNF2-related protein | - |
| AUL54_RS18380 (AUL54_18390) | gcvT | 3735359..3736459 (+) | 1101 | WP_060964773.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6719.70 Da Isoelectric Point: 9.8173
>NTDB_id=166510 AUL54_RS18365 WP_016938977.1 3732099..3732272(-) (sinI) [Bacillus sp. SDLI1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=166510 AUL54_RS18365 WP_016938977.1 3732099..3732272(-) (sinI) [Bacillus sp. SDLI1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |