Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AUL54_RS18365 Genome accession   NZ_CP013950
Coordinates   3732099..3732272 (-) Length   57 a.a.
NCBI ID   WP_016938977.1    Uniprot ID   -
Organism   Bacillus sp. SDLI1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3727099..3737272
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AUL54_RS18315 (AUL54_18325) comGD 3727219..3727656 (+) 438 WP_060964765.1 competence type IV pilus minor pilin ComGD Machinery gene
  AUL54_RS18320 (AUL54_18330) comGE 3727640..3727954 (+) 315 WP_060964766.1 competence type IV pilus minor pilin ComGE Machinery gene
  AUL54_RS18325 (AUL54_18335) comGF 3727866..3728363 (+) 498 WP_235588382.1 competence type IV pilus minor pilin ComGF -
  AUL54_RS18330 (AUL54_18340) comGG 3728364..3728741 (+) 378 WP_060964768.1 competence type IV pilus minor pilin ComGG Machinery gene
  AUL54_RS18335 (AUL54_18345) - 3728798..3728977 (+) 180 WP_022552966.1 YqzE family protein -
  AUL54_RS18340 (AUL54_18350) - 3729018..3729347 (-) 330 WP_016938972.1 DUF3889 domain-containing protein -
  AUL54_RS18345 (AUL54_18355) tapA 3729606..3730277 (+) 672 WP_060964769.1 amyloid fiber anchoring/assembly protein TapA -
  AUL54_RS18350 (AUL54_18360) - 3730249..3730833 (+) 585 WP_060964770.1 signal peptidase I -
  AUL54_RS18355 (AUL54_18365) - 3730897..3731682 (+) 786 WP_016938976.1 TasA family protein -
  AUL54_RS18360 (AUL54_18370) sinR 3731730..3732065 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AUL54_RS18365 (AUL54_18375) sinI 3732099..3732272 (-) 174 WP_016938977.1 anti-repressor SinI family protein Regulator
  AUL54_RS18370 (AUL54_18380) - 3732449..3733243 (-) 795 WP_060964771.1 YqhG family protein -
  AUL54_RS18375 (AUL54_18385) - 3733265..3734935 (-) 1671 WP_060964772.1 SNF2-related protein -
  AUL54_RS18380 (AUL54_18390) gcvT 3735359..3736459 (+) 1101 WP_060964773.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6719.70 Da        Isoelectric Point: 9.8173

>NTDB_id=166510 AUL54_RS18365 WP_016938977.1 3732099..3732272(-) (sinI) [Bacillus sp. SDLI1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=166510 AUL54_RS18365 WP_016938977.1 3732099..3732272(-) (sinI) [Bacillus sp. SDLI1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684

Multiple sequence alignment