Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   AT706_RS12485 Genome accession   NZ_CP013654
Coordinates   2436890..2437081 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain BSD-2     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 2431890..2442081
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AT706_RS12460 (AT706_12465) appD 2432217..2433203 (-) 987 WP_015383344.1 oligopeptide ABC transporter ATP-binding protein AppD -
  AT706_RS12465 (AT706_12470) yjaZ 2433396..2434181 (-) 786 WP_015383343.1 DUF2268 domain-containing protein -
  AT706_RS12470 (AT706_12475) fabF 2434257..2435498 (-) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  AT706_RS12475 (AT706_12480) fabH 2435521..2436459 (-) 939 WP_015483083.1 beta-ketoacyl-ACP synthase III -
  AT706_RS12480 (AT706_12485) yjzB 2436624..2436860 (+) 237 WP_015383342.1 spore coat protein YjzB -
  AT706_RS12485 (AT706_12490) comZ 2436890..2437081 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  AT706_RS12490 (AT706_12495) med 2437096..2438049 (-) 954 WP_014476425.1 transcriptional regulator Med Regulator
  AT706_RS12495 (AT706_12500) - 2438139..2438696 (-) 558 WP_015383340.1 hypothetical protein -
  AT706_RS12500 (AT706_12505) - 2438778..2439512 (-) 735 WP_015483082.1 hypothetical protein -
  AT706_RS12505 (AT706_12510) yjzD 2439763..2439948 (+) 186 WP_003245236.1 YjzD family protein -
  AT706_RS12510 (AT706_12515) yjzC 2439994..2440173 (-) 180 WP_003245356.1 YjzC family protein -
  AT706_RS12515 (AT706_12520) argF 2440259..2441218 (-) 960 WP_015383338.1 ornithine carbamoyltransferase -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=163541 AT706_RS12485 WP_003224559.1 2436890..2437081(-) (comZ) [Bacillus subtilis subsp. subtilis strain BSD-2]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=163541 AT706_RS12485 WP_003224559.1 2436890..2437081(-) (comZ) [Bacillus subtilis subsp. subtilis strain BSD-2]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATACAGCCGTTTATGAATCTGTTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment