Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   B34_RS05910 Genome accession   NZ_CP014793
Coordinates   1087795..1087971 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   Q65HF5
Organism   Bacillus licheniformis strain SCDB 34     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1082795..1092971
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B34_RS05895 (B34_01196) gcvT 1083437..1084531 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  B34_RS05900 (B34_01197) - 1085124..1086803 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  B34_RS05905 (B34_01198) - 1086810..1087604 (+) 795 WP_061578400.1 YqhG family protein -
  B34_RS05910 (B34_01199) sinI 1087795..1087971 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  B34_RS05915 (B34_01200) sinR 1088005..1088340 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  B34_RS05920 (B34_01201) tasA 1088445..1089239 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  B34_RS05925 (B34_01202) sipW 1089313..1089897 (-) 585 WP_003183449.1 signal peptidase I SipW -
  B34_RS05930 (B34_01203) tapA 1089894..1090622 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  B34_RS05935 (B34_01204) - 1090899..1091219 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  B34_RS05940 (B34_01205) - 1091243..1091425 (-) 183 WP_003183456.1 YqzE family protein -
  B34_RS05945 (B34_01206) comGG 1091514..1091879 (-) 366 WP_080624019.1 competence type IV pilus minor pilin ComGG Machinery gene
  B34_RS05950 (B34_01207) comGF 1091892..1092380 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  B34_RS05955 comGE 1092289..1092636 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=149874 B34_RS05910 WP_003183444.1 1087795..1087971(+) (sinI) [Bacillus licheniformis strain SCDB 34]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=149874 B34_RS05910 WP_003183444.1 1087795..1087971(+) (sinI) [Bacillus licheniformis strain SCDB 34]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterProScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q65HF5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517