Detailed information NTG0149547

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB684_RS13580
• Genome accession: NZ_CP014781
• Coordinates: 2628843..2629280 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain HRBL-15TDI7
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2623843..2634280

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB684_RS13530 (AB684_13530)	sinI	2624018..2624194 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
AB684_RS13535 (AB684_13535)	sinR	2624228..2624563 (+)	336	WP_025804940.1	transcriptional regulator SinR	Regulator
AB684_RS13540 (AB684_13540)	tasA	2624668..2625462 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
AB684_RS13545 (AB684_13545)	sipW	2625536..2626120 (-)	585	WP_003183449.1	signal peptidase I SipW	-
AB684_RS13550 (AB684_13550)	tapA	2626117..2626845 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
AB684_RS13555 (AB684_13555)	-	2627122..2627442 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
AB684_RS13560 (AB684_13560)	-	2627466..2627648 (-)	183	WP_003183456.1	YqzE family protein	-
AB684_RS13565 (AB684_13565)	comGG	2627737..2628102 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
AB684_RS13570 (AB684_13570)	comGF	2628115..2628495 (-)	381	WP_016885935.1	competence type IV pilus minor pilin ComGF	Machinery gene
AB684_RS13575 (AB684_13575)	comGE	2628512..2628859 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
AB684_RS13580 (AB684_13580)	comGD	2628843..2629280 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB684_RS13585 (AB684_13585)	comGC	2629286..2629579 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
AB684_RS13590 (AB684_13590)	comGB	2629593..2630627 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB684_RS13595 (AB684_13595)	comGA	2630617..2631681 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
AB684_RS13600 (AB684_13600)	-	2631838..2632677 (-)	840	WP_003183480.1	STAS domain-containing protein	-
AB684_RS13610 (AB684_13610)	-	2632919..2633296 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
AB684_RS13615 (AB684_13615)	-	2633505..2633750 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=149547 AB684_RS13580 WP_009327905.1 2628843..2629280(-) (comGD) [Bacillus licheniformis strain HRBL-15TDI7]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=149547 AB684_RS13580 WP_009327905.1 2628843..2629280(-) (comGD) [Bacillus licheniformis strain HRBL-15TDI7]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393