Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   AB684_RS13570 Genome accession   NZ_CP014781
Coordinates   2628115..2628495 (-) Length   126 a.a.
NCBI ID   WP_016885935.1    Uniprot ID   -
Organism   Bacillus licheniformis strain HRBL-15TDI7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2623115..2633495
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB684_RS13530 (AB684_13530) sinI 2624018..2624194 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  AB684_RS13535 (AB684_13535) sinR 2624228..2624563 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  AB684_RS13540 (AB684_13540) tasA 2624668..2625462 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  AB684_RS13545 (AB684_13545) sipW 2625536..2626120 (-) 585 WP_003183449.1 signal peptidase I SipW -
  AB684_RS13550 (AB684_13550) tapA 2626117..2626845 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  AB684_RS13555 (AB684_13555) - 2627122..2627442 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  AB684_RS13560 (AB684_13560) - 2627466..2627648 (-) 183 WP_003183456.1 YqzE family protein -
  AB684_RS13565 (AB684_13565) comGG 2627737..2628102 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  AB684_RS13570 (AB684_13570) comGF 2628115..2628495 (-) 381 WP_016885935.1 competence type IV pilus minor pilin ComGF Machinery gene
  AB684_RS13575 (AB684_13575) comGE 2628512..2628859 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  AB684_RS13580 (AB684_13580) comGD 2628843..2629280 (-) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB684_RS13585 (AB684_13585) comGC 2629286..2629579 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  AB684_RS13590 (AB684_13590) comGB 2629593..2630627 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB684_RS13595 (AB684_13595) comGA 2630617..2631681 (-) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  AB684_RS13600 (AB684_13600) - 2631838..2632677 (-) 840 WP_003183480.1 STAS domain-containing protein -
  AB684_RS13610 (AB684_13610) - 2632919..2633296 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -

Sequence

Protein


Download         Length: 126 a.a.        Molecular weight: 14546.78 Da        Isoelectric Point: 10.3094

>NTDB_id=149546 AB684_RS13570 WP_016885935.1 2628115..2628495(-) (comGF) [Bacillus licheniformis strain HRBL-15TDI7]
MVHMFVAGTMASIFHLFLSPERNGSDIHPREWTITAEQILKESRNSIDIRSAGDHQSLAMTNRQGDTVRYEQYQTVIRKR
VNGKGHVPLLQHVKKMRFMIENHLLILEATSLSGKSYRTSIPLYHM

Nucleotide


Download         Length: 381 bp        

>NTDB_id=149546 AB684_RS13570 WP_016885935.1 2628115..2628495(-) (comGF) [Bacillus licheniformis strain HRBL-15TDI7]
ATGGTGCACATGTTCGTTGCAGGTACGATGGCCTCGATATTTCATCTGTTTTTATCCCCGGAAAGAAACGGTTCGGATAT
TCACCCCCGTGAATGGACGATTACTGCCGAGCAAATATTGAAGGAGTCTAGGAATTCGATTGACATAAGAAGTGCCGGTG
ATCATCAGTCACTAGCGATGACAAACCGCCAAGGTGACACCGTTCGCTATGAGCAATATCAGACAGTTATTCGAAAAAGG
GTCAATGGAAAAGGTCATGTGCCTCTATTACAGCATGTCAAAAAAATGAGGTTTATGATTGAAAATCACCTGCTGATCCT
TGAAGCGACAAGTCTAAGCGGCAAATCATACCGCACGTCTATTCCGCTCTATCATATGTAA

Domains

Predicted by InterProScan.

Putative Competence protein ComGF (ComGF)

(22-117)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

38.843

96.032

0.373