Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AAV34_RS17455 Genome accession   NZ_CP011937
Coordinates   3533003..3533122 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CBMB205     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3528003..3538122
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV34_RS17430 (AAV34_16995) - 3528242..3529000 (-) 759 WP_007609404.1 ABC transporter ATP-binding protein -
  AAV34_RS17435 (AAV34_17000) - 3528994..3529941 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  AAV34_RS17440 (AAV34_17005) ceuB 3529931..3530884 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  AAV34_RS17445 (AAV34_17010) - 3531298..3532662 (+) 1365 WP_007609394.1 aspartate kinase -
  AAV34_RS17450 (AAV34_17015) - 3532742..3532852 (+) 111 WP_369878517.1 YjcZ family sporulation protein -
  AAV34_RS17455 (AAV34_17020) phrC 3533003..3533122 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AAV34_RS17460 (AAV34_17025) rapC 3533106..3534254 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AAV34_RS17465 (AAV34_17030) - 3534407..3535840 (-) 1434 WP_161503657.1 sensor histidine kinase -
  AAV34_RS17470 (AAV34_17035) - 3535827..3536510 (-) 684 WP_032872879.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=149459 AAV34_RS17455 WP_003156334.1 3533003..3533122(-) (phrC) [Bacillus velezensis strain CBMB205]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=149459 AAV34_RS17455 WP_003156334.1 3533003..3533122(-) (phrC) [Bacillus velezensis strain CBMB205]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment