Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AAV34_RS07805 | Genome accession | NZ_CP011937 |
| Coordinates | 1495252..1495425 (-) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain CBMB205 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1490252..1500425
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAV34_RS07755 (AAV34_07595) | comGD | 1490371..1490808 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AAV34_RS07760 (AAV34_07600) | comGE | 1490792..1491106 (+) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AAV34_RS07765 (AAV34_07605) | comGF | 1491051..1491515 (+) | 465 | WP_223813077.1 | competence type IV pilus minor pilin ComGF | - |
| AAV34_RS07770 (AAV34_07610) | comGG | 1491516..1491893 (+) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AAV34_RS07775 (AAV34_07615) | - | 1491950..1492129 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| AAV34_RS07780 (AAV34_07620) | - | 1492170..1492499 (-) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| AAV34_RS07785 (AAV34_07625) | tapA | 1492758..1493429 (+) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AAV34_RS07790 (AAV34_07630) | sipW | 1493401..1493985 (+) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| AAV34_RS07795 (AAV34_07635) | tasA | 1494050..1494835 (+) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| AAV34_RS07800 (AAV34_07640) | sinR | 1494883..1495218 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AAV34_RS07805 (AAV34_07645) | sinI | 1495252..1495425 (-) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| AAV34_RS07810 (AAV34_07650) | - | 1495602..1496396 (-) | 795 | WP_007612541.1 | YqhG family protein | - |
| AAV34_RS07815 (AAV34_07655) | - | 1496418..1498088 (-) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| AAV34_RS07820 (AAV34_07660) | gcvT | 1498511..1499611 (+) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=149429 AAV34_RS07805 WP_032874029.1 1495252..1495425(-) (sinI) [Bacillus velezensis strain CBMB205]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=149429 AAV34_RS07805 WP_032874029.1 1495252..1495425(-) (sinI) [Bacillus velezensis strain CBMB205]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |