Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ABU16_RS21195 Genome accession   NZ_CP011882
Coordinates   4070489..4070629 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain TO-A JPC     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 4065489..4075629
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABU16_RS21170 (ABU16_4204) yuxO 4065839..4066219 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ABU16_RS21175 (ABU16_4205) comA 4066238..4066882 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABU16_RS21180 (ABU16_4206) - 4066963..4069260 (-) 2298 Protein_4116 histidine kinase -
  ABU16_RS21185 (ABU16_4208) comX 4069268..4069429 (-) 162 WP_003228803.1 competence pheromone ComX -
  ABU16_RS21190 (ABU16_4209) - 4069444..4070304 (-) 861 WP_029318489.1 polyprenyl synthetase family protein -
  ABU16_RS21195 (ABU16_4210) degQ 4070489..4070629 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABU16_RS22635 (ABU16_4211) - 4070851..4070976 (+) 126 WP_003228793.1 hypothetical protein -
  ABU16_RS21200 (ABU16_4212) - 4071090..4071458 (+) 369 WP_014477834.1 hypothetical protein -
  ABU16_RS21205 (ABU16_4213) pdeH 4071434..4072663 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  ABU16_RS21210 (ABU16_4214) pncB 4072800..4074272 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABU16_RS21215 (ABU16_4215) pncA 4074288..4074839 (-) 552 WP_048217610.1 isochorismatase family cysteine hydrolase -
  ABU16_RS21220 (ABU16_4216) yueI 4074936..4075334 (-) 399 WP_019712929.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=149218 ABU16_RS21195 WP_003220708.1 4070489..4070629(-) (degQ) [Bacillus subtilis strain TO-A JPC]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=149218 ABU16_RS21195 WP_003220708.1 4070489..4070629(-) (degQ) [Bacillus subtilis strain TO-A JPC]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment