Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AS588_RS12255 Genome accession   NZ_CP014700
Coordinates   2578471..2578590 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain S499     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2573471..2583590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS588_RS12235 (AS588_12235) - 2573710..2574468 (-) 759 WP_015388706.1 ABC transporter ATP-binding protein -
  AS588_RS12240 (AS588_12240) - 2574462..2575409 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  AS588_RS12245 (AS588_12245) ceuB 2575399..2576352 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  AS588_RS12250 (AS588_12250) - 2576767..2578131 (+) 1365 WP_014304341.1 aspartate kinase -
  AS588_RS19525 - 2578211..2578321 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  AS588_RS12255 (AS588_12255) phrC 2578471..2578590 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AS588_RS12260 (AS588_12260) rapC 2578574..2579722 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  AS588_RS12265 (AS588_12265) - 2579875..2581308 (-) 1434 WP_161625271.1 sensor histidine kinase -
  AS588_RS12270 (AS588_12270) - 2581295..2581978 (-) 684 WP_015388707.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=149176 AS588_RS12255 WP_003156334.1 2578471..2578590(-) (phrC) [Bacillus amyloliquefaciens strain S499]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=149176 AS588_RS12255 WP_003156334.1 2578471..2578590(-) (phrC) [Bacillus amyloliquefaciens strain S499]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment