Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABH13_RS14765 Genome accession   NZ_CP011686
Coordinates   3053635..3053775 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain G341     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3048635..3058775
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABH13_RS14740 (ABH13_2977) - 3048931..3049314 (-) 384 WP_032869799.1 hotdog fold thioesterase -
  ABH13_RS14745 (ABH13_2978) comA 3049336..3049980 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ABH13_RS14750 (ABH13_2979) comP 3050061..3052370 (-) 2310 WP_033574914.1 histidine kinase Regulator
  ABH13_RS14755 - 3052390..3052566 (-) 177 WP_007408675.1 competence pheromone ComX -
  ABH13_RS14760 (ABH13_2980) comQ 3052566..3053504 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  ABH13_RS14765 (ABH13_2981) degQ 3053635..3053775 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ABH13_RS14770 (ABH13_2982) - 3054238..3054579 (+) 342 WP_007408677.1 hypothetical protein -
  ABH13_RS14775 (ABH13_2983) - 3054586..3055809 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ABH13_RS14780 (ABH13_2984) - 3055939..3057405 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  ABH13_RS14785 (ABH13_2985) - 3057423..3057974 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ABH13_RS14790 (ABH13_2986) - 3058071..3058469 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=147477 ABH13_RS14765 WP_003152043.1 3053635..3053775(-) (degQ) [Bacillus velezensis strain G341]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=147477 ABH13_RS14765 WP_003152043.1 3053635..3053775(-) (degQ) [Bacillus velezensis strain G341]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment