Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ABH13_RS14765 | Genome accession | NZ_CP011686 |
| Coordinates | 3053635..3053775 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain G341 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3048635..3058775
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABH13_RS14740 (ABH13_2977) | - | 3048931..3049314 (-) | 384 | WP_032869799.1 | hotdog fold thioesterase | - |
| ABH13_RS14745 (ABH13_2978) | comA | 3049336..3049980 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| ABH13_RS14750 (ABH13_2979) | comP | 3050061..3052370 (-) | 2310 | WP_033574914.1 | histidine kinase | Regulator |
| ABH13_RS14755 | - | 3052390..3052566 (-) | 177 | WP_007408675.1 | competence pheromone ComX | - |
| ABH13_RS14760 (ABH13_2980) | comQ | 3052566..3053504 (-) | 939 | WP_020954300.1 | polyprenyl synthetase family protein | Regulator |
| ABH13_RS14765 (ABH13_2981) | degQ | 3053635..3053775 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ABH13_RS14770 (ABH13_2982) | - | 3054238..3054579 (+) | 342 | WP_007408677.1 | hypothetical protein | - |
| ABH13_RS14775 (ABH13_2983) | - | 3054586..3055809 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| ABH13_RS14780 (ABH13_2984) | - | 3055939..3057405 (-) | 1467 | WP_020954301.1 | nicotinate phosphoribosyltransferase | - |
| ABH13_RS14785 (ABH13_2985) | - | 3057423..3057974 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| ABH13_RS14790 (ABH13_2986) | - | 3058071..3058469 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=147477 ABH13_RS14765 WP_003152043.1 3053635..3053775(-) (degQ) [Bacillus velezensis strain G341]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=147477 ABH13_RS14765 WP_003152043.1 3053635..3053775(-) (degQ) [Bacillus velezensis strain G341]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |