Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABA10_RS15740 Genome accession   NZ_CP011534
Coordinates   3056102..3056242 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain UD1022     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3051102..3061242
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABA10_RS15715 (ABA10_15715) yuxO 3051379..3051759 (-) 381 WP_047183110.1 hotdog fold thioesterase -
  ABA10_RS15720 (ABA10_15720) comA 3051778..3052422 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABA10_RS15725 (ABA10_15725) comP 3052503..3054815 (-) 2313 WP_047183111.1 histidine kinase Regulator
  ABA10_RS15730 (ABA10_15730) comX 3054831..3055052 (-) 222 WP_014114983.1 competence pheromone ComX -
  ABA10_RS15735 (ABA10_15735) - 3055049..3055918 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  ABA10_RS15740 (ABA10_15740) degQ 3056102..3056242 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABA10_RS22070 - 3056464..3056526 (+) 63 Protein_3039 hypothetical protein -
  ABA10_RS15745 (ABA10_15745) - 3056704..3057072 (+) 369 WP_047183112.1 hypothetical protein -
  ABA10_RS15750 (ABA10_15750) pdeH 3057048..3058277 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ABA10_RS15755 (ABA10_15755) pncB 3058414..3059886 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABA10_RS15760 (ABA10_15760) pncA 3059902..3060453 (-) 552 WP_047183113.1 isochorismatase family cysteine hydrolase -
  ABA10_RS15765 (ABA10_15765) yueI 3060550..3060948 (-) 399 WP_014477837.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=146767 ABA10_RS15740 WP_003220708.1 3056102..3056242(-) (degQ) [Bacillus subtilis strain UD1022]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=146767 ABA10_RS15740 WP_003220708.1 3056102..3056242(-) (degQ) [Bacillus subtilis strain UD1022]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment