Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AAV30_RS17240 Genome accession   NZ_CP011347
Coordinates   3614575..3614694 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain YJ11-1-4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3609575..3619694
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV30_RS17220 (AAV30_17220) - 3609817..3610575 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  AAV30_RS17225 (AAV30_17225) - 3610569..3611516 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  AAV30_RS17230 (AAV30_17230) ceuB 3611506..3612459 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  AAV30_RS17235 (AAV30_17235) - 3612873..3614237 (+) 1365 WP_042634827.1 aspartate kinase -
  AAV30_RS19860 - 3614317..3614427 (+) 111 WP_369878517.1 YjcZ family sporulation protein -
  AAV30_RS17240 (AAV30_17240) phrC 3614575..3614694 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AAV30_RS17245 (AAV30_17245) rapC 3614678..3615826 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AAV30_RS17250 (AAV30_17250) - 3615979..3617412 (-) 1434 WP_020953885.1 ATP-binding protein -
  AAV30_RS17255 (AAV30_17255) - 3617399..3618082 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=144959 AAV30_RS17240 WP_003156334.1 3614575..3614694(-) (phrC) [Bacillus velezensis strain YJ11-1-4]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=144959 AAV30_RS17240 WP_003156334.1 3614575..3614694(-) (phrC) [Bacillus velezensis strain YJ11-1-4]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment