Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AAV30_RS07525 | Genome accession | NZ_CP011347 |
| Coordinates | 1471543..1471716 (-) | Length | 57 a.a. |
| NCBI ID | WP_007612543.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain YJ11-1-4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1466543..1476716
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAV30_RS07475 (AAV30_07475) | comGD | 1466662..1467099 (+) | 438 | WP_038459181.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AAV30_RS07480 (AAV30_07480) | comGE | 1467083..1467397 (+) | 315 | WP_038459179.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AAV30_RS07485 (AAV30_07485) | comGF | 1467306..1467806 (+) | 501 | WP_228842201.1 | competence type IV pilus minor pilin ComGF | - |
| AAV30_RS07490 (AAV30_07490) | comGG | 1467807..1468184 (+) | 378 | WP_038459177.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AAV30_RS07495 (AAV30_07495) | - | 1468241..1468420 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| AAV30_RS07500 (AAV30_07500) | - | 1468461..1468790 (-) | 330 | WP_038459175.1 | DUF3889 domain-containing protein | - |
| AAV30_RS07505 (AAV30_07505) | tapA | 1469049..1469720 (+) | 672 | WP_038459173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AAV30_RS07510 (AAV30_07510) | sipW | 1469692..1470276 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| AAV30_RS07515 (AAV30_07515) | tasA | 1470341..1471126 (+) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| AAV30_RS07520 (AAV30_07520) | sinR | 1471174..1471509 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AAV30_RS07525 (AAV30_07525) | sinI | 1471543..1471716 (-) | 174 | WP_007612543.1 | anti-repressor SinI | Regulator |
| AAV30_RS07530 (AAV30_07530) | - | 1471893..1472687 (-) | 795 | WP_007612541.1 | YqhG family protein | - |
| AAV30_RS07535 (AAV30_07535) | - | 1472709..1474378 (-) | 1670 | Protein_1501 | DEAD/DEAH box helicase | - |
| AAV30_RS07540 (AAV30_07540) | gcvT | 1474802..1475902 (+) | 1101 | WP_038459167.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6672.68 Da Isoelectric Point: 9.8168
>NTDB_id=144932 AAV30_RS07525 WP_007612543.1 1471543..1471716(-) (sinI) [Bacillus velezensis strain YJ11-1-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=144932 AAV30_RS07525 WP_007612543.1 1471543..1471716(-) (sinI) [Bacillus velezensis strain YJ11-1-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |