Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   AAV30_RS07480 Genome accession   NZ_CP011347
Coordinates   1467083..1467397 (+) Length   104 a.a.
NCBI ID   WP_038459179.1    Uniprot ID   -
Organism   Bacillus velezensis strain YJ11-1-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1462083..1472397
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV30_RS07455 (AAV30_07455) - 1463118..1464068 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  AAV30_RS07460 (AAV30_07460) comGA 1464265..1465335 (+) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  AAV30_RS07465 (AAV30_07465) comGB 1465322..1466359 (+) 1038 WP_038459183.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAV30_RS07470 (AAV30_07470) comGC 1466364..1466672 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AAV30_RS07475 (AAV30_07475) comGD 1466662..1467099 (+) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAV30_RS07480 (AAV30_07480) comGE 1467083..1467397 (+) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAV30_RS07485 (AAV30_07485) comGF 1467306..1467806 (+) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  AAV30_RS07490 (AAV30_07490) comGG 1467807..1468184 (+) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAV30_RS07495 (AAV30_07495) - 1468241..1468420 (+) 180 WP_022552966.1 YqzE family protein -
  AAV30_RS07500 (AAV30_07500) - 1468461..1468790 (-) 330 WP_038459175.1 DUF3889 domain-containing protein -
  AAV30_RS07505 (AAV30_07505) tapA 1469049..1469720 (+) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  AAV30_RS07510 (AAV30_07510) sipW 1469692..1470276 (+) 585 WP_012117977.1 signal peptidase I SipW -
  AAV30_RS07515 (AAV30_07515) tasA 1470341..1471126 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  AAV30_RS07520 (AAV30_07520) sinR 1471174..1471509 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AAV30_RS07525 (AAV30_07525) sinI 1471543..1471716 (-) 174 WP_007612543.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11932.91 Da        Isoelectric Point: 5.8321

>NTDB_id=144929 AAV30_RS07480 WP_038459179.1 1467083..1467397(+) (comGE) [Bacillus velezensis strain YJ11-1-4]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=144929 AAV30_RS07480 WP_038459179.1 1467083..1467397(+) (comGE) [Bacillus velezensis strain YJ11-1-4]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment