Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AAV29_RS01905 Genome accession   NZ_CP011346
Coordinates   380185..380304 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain JJ-D34     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 375185..385304
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV29_RS01890 (AAV29_01890) - 376797..377480 (+) 684 WP_003156341.1 response regulator transcription factor -
  AAV29_RS01895 (AAV29_01895) - 377467..378900 (+) 1434 WP_161625271.1 sensor histidine kinase -
  AAV29_RS01900 (AAV29_01900) rapC 379053..380201 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  AAV29_RS01905 (AAV29_01905) phrC 380185..380304 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AAV29_RS20315 - 380456..380566 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  AAV29_RS01910 (AAV29_01910) - 380646..382010 (-) 1365 WP_046559345.1 aspartate kinase -
  AAV29_RS01915 (AAV29_01915) ceuB 382425..383378 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  AAV29_RS01920 (AAV29_01920) - 383368..384315 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  AAV29_RS01925 (AAV29_01925) - 384309..385067 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=144830 AAV29_RS01905 WP_003156334.1 380185..380304(+) (phrC) [Bacillus velezensis strain JJ-D34]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=144830 AAV29_RS01905 WP_003156334.1 380185..380304(+) (phrC) [Bacillus velezensis strain JJ-D34]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment