Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AWM80_RS12330 Genome accession   NZ_CP014166
Coordinates   2396846..2397220 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   P25959
Organism   Bacillus subtilis subsp. subtilis strain CU1050     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2391846..2402220
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWM80_RS12290 (AWM80_12295) yqhG 2392178..2392972 (+) 795 WP_003230200.1 YqhG family protein -
  AWM80_RS12295 (AWM80_12300) sinI 2393155..2393328 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AWM80_RS12300 (AWM80_12305) sinR 2393362..2393697 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AWM80_RS12305 (AWM80_12310) tasA 2393790..2394575 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  AWM80_RS12310 (AWM80_12315) sipW 2394639..2395211 (-) 573 WP_003246088.1 signal peptidase I SipW -
  AWM80_RS12315 (AWM80_12320) tapA 2395195..2395956 (-) 762 Protein_2355 amyloid fiber anchoring/assembly protein TapA -
  AWM80_RS12320 (AWM80_12325) yqzG 2396228..2396554 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AWM80_RS12325 (AWM80_12330) spoIITA 2396596..2396775 (-) 180 WP_003230176.1 YqzE family protein -
  AWM80_RS12330 (AWM80_12335) comGG 2396846..2397220 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AWM80_RS12335 (AWM80_12340) comGF 2397221..2397604 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AWM80_RS12340 (AWM80_12345) comGE 2397630..2397977 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AWM80_RS12345 (AWM80_12350) comGD 2397961..2398392 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AWM80_RS12350 (AWM80_12355) comGC 2398382..2398678 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AWM80_RS12355 (AWM80_12360) comGB 2398692..2399729 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  AWM80_RS12360 (AWM80_12365) comGA 2399716..2400786 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AWM80_RS12370 (AWM80_12375) corA 2401198..2402151 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=144574 AWM80_RS12330 WP_003230170.1 2396846..2397220(-) (comGG) [Bacillus subtilis subsp. subtilis strain CU1050]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=144574 AWM80_RS12330 WP_003230170.1 2396846..2397220(-) (comGG) [Bacillus subtilis subsp. subtilis strain CU1050]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25959

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment