Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   XM40_RS14375 Genome accession   NZ_CP011278
Coordinates   2996450..2996590 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain L-S60     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2991450..3001590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  XM40_RS14350 (XM40_14350) - 2991756..2992139 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  XM40_RS14355 (XM40_14355) comA 2992161..2992805 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  XM40_RS14360 (XM40_14360) comP 2992886..2995180 (-) 2295 WP_046376725.1 histidine kinase Regulator
  XM40_RS14365 (XM40_14365) comX 2995200..2995379 (-) 180 WP_306383677.1 competence pheromone ComX -
  XM40_RS14370 (XM40_14370) comQ 2995333..2996319 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  XM40_RS14375 (XM40_14375) degQ 2996450..2996590 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  XM40_RS14380 (XM40_14380) - 2997056..2997397 (+) 342 WP_014305721.1 hypothetical protein -
  XM40_RS14385 (XM40_14385) - 2997404..2998624 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  XM40_RS14390 (XM40_14390) - 2998754..3000220 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  XM40_RS14395 (XM40_14395) - 3000238..3000789 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  XM40_RS14400 (XM40_14400) - 3000886..3001284 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=144144 XM40_RS14375 WP_003152043.1 2996450..2996590(-) (degQ) [Bacillus velezensis strain L-S60]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=144144 XM40_RS14375 WP_003152043.1 2996450..2996590(-) (degQ) [Bacillus velezensis strain L-S60]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment