Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   WV34_RS12150 Genome accession   NZ_CP011252
Coordinates   2417719..2418033 (-) Length   104 a.a.
NCBI ID   WP_045510593.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MT45     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2412719..2423033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WV34_RS12105 (WV34_11820) sinI 2413400..2413573 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  WV34_RS12110 (WV34_11825) sinR 2413607..2413942 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  WV34_RS12115 (WV34_11830) - 2413990..2414775 (-) 786 WP_013352862.1 TasA family protein -
  WV34_RS12120 (WV34_11835) - 2414840..2415424 (-) 585 WP_065522773.1 signal peptidase I -
  WV34_RS12125 (WV34_11840) tapA 2415396..2416067 (-) 672 WP_088613114.1 amyloid fiber anchoring/assembly protein TapA -
  WV34_RS12130 (WV34_11845) - 2416325..2416654 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  WV34_RS12135 (WV34_11850) - 2416695..2416874 (-) 180 WP_016938971.1 YqzE family protein -
  WV34_RS12140 (WV34_11855) comGG 2416931..2417308 (-) 378 WP_088613115.1 competence type IV pilus minor pilin ComGG Machinery gene
  WV34_RS12145 (WV34_11860) comGF 2417310..2417810 (-) 501 WP_235608361.1 competence type IV pilus minor pilin ComGF -
  WV34_RS12150 (WV34_11865) comGE 2417719..2418033 (-) 315 WP_045510593.1 competence type IV pilus minor pilin ComGE Machinery gene
  WV34_RS12155 (WV34_11870) comGD 2418017..2418454 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene
  WV34_RS12160 (WV34_11875) comGC 2418444..2418710 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  WV34_RS12165 (WV34_11880) comGB 2418757..2419794 (-) 1038 WP_088613117.1 competence type IV pilus assembly protein ComGB Machinery gene
  WV34_RS12170 (WV34_11885) comGA 2419781..2420851 (-) 1071 WP_088613118.1 competence type IV pilus ATPase ComGA Machinery gene
  WV34_RS12175 (WV34_11890) - 2421045..2421995 (-) 951 WP_088613119.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11895.90 Da        Isoelectric Point: 7.1305

>NTDB_id=143892 WV34_RS12150 WP_045510593.1 2417719..2418033(-) (comGE) [Bacillus amyloliquefaciens strain MT45]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEERQEVYQLLHKHISAYMMSGKKQPSPGVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=143892 WV34_RS12150 WP_045510593.1 2417719..2418033(-) (comGE) [Bacillus amyloliquefaciens strain MT45]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACGCCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAACAGCCGTCTCCCGGTGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCGGCTGTACGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49

Multiple sequence alignment