Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WV34_RS12105 Genome accession   NZ_CP011252
Coordinates   2413400..2413573 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain MT45     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2408400..2418573
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WV34_RS12090 (WV34_11805) gcvT 2409210..2410310 (-) 1101 WP_088613111.1 glycine cleavage system aminomethyltransferase GcvT -
  WV34_RS12095 (WV34_11810) - 2410735..2412405 (+) 1671 WP_088613112.1 SNF2-related protein -
  WV34_RS12100 (WV34_11815) - 2412426..2413220 (+) 795 WP_088613113.1 YqhG family protein -
  WV34_RS12105 (WV34_11820) sinI 2413400..2413573 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  WV34_RS12110 (WV34_11825) sinR 2413607..2413942 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  WV34_RS12115 (WV34_11830) - 2413990..2414775 (-) 786 WP_013352862.1 TasA family protein -
  WV34_RS12120 (WV34_11835) - 2414840..2415424 (-) 585 WP_065522773.1 signal peptidase I -
  WV34_RS12125 (WV34_11840) tapA 2415396..2416067 (-) 672 WP_088613114.1 amyloid fiber anchoring/assembly protein TapA -
  WV34_RS12130 (WV34_11845) - 2416325..2416654 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  WV34_RS12135 (WV34_11850) - 2416695..2416874 (-) 180 WP_016938971.1 YqzE family protein -
  WV34_RS12140 (WV34_11855) comGG 2416931..2417308 (-) 378 WP_088613115.1 competence type IV pilus minor pilin ComGG Machinery gene
  WV34_RS12145 (WV34_11860) comGF 2417310..2417810 (-) 501 WP_235608361.1 competence type IV pilus minor pilin ComGF -
  WV34_RS12150 (WV34_11865) comGE 2417719..2418033 (-) 315 WP_045510593.1 competence type IV pilus minor pilin ComGE Machinery gene
  WV34_RS12155 (WV34_11870) comGD 2418017..2418454 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=143889 WV34_RS12105 WP_013352860.1 2413400..2413573(+) (sinI) [Bacillus amyloliquefaciens strain MT45]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=143889 WV34_RS12105 WP_013352860.1 2413400..2413573(+) (sinI) [Bacillus amyloliquefaciens strain MT45]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTGGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684

Multiple sequence alignment