Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   VT48_RS14745 Genome accession   NZ_CP011150
Coordinates   2877608..2877748 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain W3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2872608..2882748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VT48_RS14720 (VT48_14720) - 2872930..2873319 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  VT48_RS14725 (VT48_14725) comA 2873343..2873984 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  VT48_RS14730 (VT48_14730) comP 2874065..2876371 (-) 2307 WP_017358942.1 ATP-binding protein Regulator
  VT48_RS14735 (VT48_14735) comX 2876385..2876555 (-) 171 WP_017358941.1 competence pheromone ComX -
  VT48_RS14740 (VT48_14740) - 2876533..2877456 (-) 924 WP_017367962.1 polyprenyl synthetase family protein -
  VT48_RS14745 (VT48_14745) degQ 2877608..2877748 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  VT48_RS14750 (VT48_14750) - 2878254..2878607 (+) 354 WP_017358939.1 hypothetical protein -
  VT48_RS14755 (VT48_14755) - 2878644..2879870 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  VT48_RS14760 (VT48_14760) - 2880010..2881479 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  VT48_RS14765 (VT48_14765) - 2881497..2882048 (-) 552 WP_025207909.1 cysteine hydrolase family protein -
  VT48_RS14770 (VT48_14770) - 2882109..2882516 (-) 408 WP_046344389.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=142853 VT48_RS14745 WP_003213123.1 2877608..2877748(-) (degQ) [Bacillus altitudinis strain W3]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=142853 VT48_RS14745 WP_003213123.1 2877608..2877748(-) (degQ) [Bacillus altitudinis strain W3]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment