Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | O7A_RS13425 | Genome accession | NZ_CP011115 |
| Coordinates | 2552445..2552618 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547445..2557618
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O7A_RS13410 (O7A_13410) | gcvT | 2548244..2549332 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| O7A_RS13415 (O7A_13415) | hepAA | 2549774..2551447 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| O7A_RS13420 (O7A_13420) | yqhG | 2551468..2552262 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| O7A_RS13425 (O7A_13425) | sinI | 2552445..2552618 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| O7A_RS13430 (O7A_13430) | sinR | 2552652..2552987 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| O7A_RS13435 (O7A_13435) | tasA | 2553080..2553865 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| O7A_RS13440 (O7A_13440) | sipW | 2553929..2554501 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| O7A_RS13445 (O7A_13445) | tapA | 2554485..2555246 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| O7A_RS13450 (O7A_13450) | yqzG | 2555518..2555844 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| O7A_RS13455 (O7A_13455) | spoIITA | 2555886..2556065 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| O7A_RS13460 (O7A_13460) | comGG | 2556136..2556510 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| O7A_RS13465 (O7A_13465) | comGF | 2556511..2556894 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| O7A_RS13470 (O7A_13470) | comGE | 2556920..2557267 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=142443 O7A_RS13425 WP_003230187.1 2552445..2552618(+) (sinI) [Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=142443 O7A_RS13425 WP_003230187.1 2552445..2552618(+) (sinI) [Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |