Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   O7A_RS13470 Genome accession   NZ_CP011115
Coordinates   2556920..2557267 (-) Length   115 a.a.
NCBI ID   WP_003230165.1    Uniprot ID   A0AAE2SKU3
Organism   Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551920..2562267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O7A_RS13425 (O7A_13425) sinI 2552445..2552618 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  O7A_RS13430 (O7A_13430) sinR 2552652..2552987 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  O7A_RS13435 (O7A_13435) tasA 2553080..2553865 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  O7A_RS13440 (O7A_13440) sipW 2553929..2554501 (-) 573 WP_003246088.1 signal peptidase I SipW -
  O7A_RS13445 (O7A_13445) tapA 2554485..2555246 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  O7A_RS13450 (O7A_13450) yqzG 2555518..2555844 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  O7A_RS13455 (O7A_13455) spoIITA 2555886..2556065 (-) 180 WP_003230176.1 YqzE family protein -
  O7A_RS13460 (O7A_13460) comGG 2556136..2556510 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  O7A_RS13465 (O7A_13465) comGF 2556511..2556894 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  O7A_RS13470 (O7A_13470) comGE 2556920..2557267 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  O7A_RS13475 (O7A_13475) comGD 2557251..2557682 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  O7A_RS13480 (O7A_13480) comGC 2557672..2557968 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  O7A_RS13485 (O7A_13485) comGB 2557982..2559019 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  O7A_RS13490 (O7A_13490) comGA 2559006..2560076 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  O7A_RS13500 (O7A_13500) corA 2560488..2561441 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13271.33 Da        Isoelectric Point: 5.1901

>NTDB_id=142447 O7A_RS13470 WP_003230165.1 2556920..2557267(-) (comGE) [Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028]
MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVMSGEGAASKTITKNNHIYAMK
WEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=142447 O7A_RS13470 WP_003230165.1 2556920..2557267(-) (comGE) [Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTGTGCTGCTGACAGT
CGTCCCCTTGTGGGACAAGCTGATGGCTGATGAAAAAATGGCGGAATCACGAGAAATTGGCTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGAGTGGTGAAGGAGCCGCGTCAAAAACGATTACAAAGAACAATCATATCTATGCAATGAAG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGTATCAAAGCCGCAGCTTATAAAGAAAAATCATTTTGCCTCAGCATTTT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment