Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BIS30_RS05395 Genome accession   NZ_CP011051
Coordinates   985914..986054 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii strain T30     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 980914..991054
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BIS30_RS05370 (BIS30_05370) - 981239..981619 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  BIS30_RS05375 (BIS30_05375) comA 981635..982279 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BIS30_RS05380 (BIS30_05380) comP 982360..984684 (-) 2325 WP_003220714.1 histidine kinase Regulator
  BIS30_RS05385 (BIS30_05385) comX 984692..984856 (-) 165 WP_003220712.1 competence pheromone ComX -
  BIS30_RS05390 (BIS30_05390) - 984869..985729 (-) 861 WP_003220710.1 polyprenyl synthetase family protein -
  BIS30_RS05395 (BIS30_05395) degQ 985914..986054 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BIS30_RS20855 - 986286..986402 (+) 117 WP_136975871.1 hypothetical protein -
  BIS30_RS05400 (BIS30_05400) - 986517..986885 (+) 369 WP_003220698.1 hypothetical protein -
  BIS30_RS05405 (BIS30_05405) pdeH 986861..988090 (-) 1230 WP_003220696.1 cyclic di-GMP phosphodiesterase -
  BIS30_RS05410 (BIS30_05410) - 988225..989697 (-) 1473 WP_003220693.1 nicotinate phosphoribosyltransferase -
  BIS30_RS05415 (BIS30_05415) - 989713..990264 (-) 552 WP_003220692.1 cysteine hydrolase family protein -
  BIS30_RS05420 (BIS30_05420) - 990361..990759 (-) 399 WP_003220689.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=141772 BIS30_RS05395 WP_003220708.1 985914..986054(-) (degQ) [Bacillus spizizenii strain T30]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=141772 BIS30_RS05395 WP_003220708.1 985914..986054(-) (degQ) [Bacillus spizizenii strain T30]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment