Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   UP12_RS14960 Genome accession   NZ_CP011007
Coordinates   2938432..2938572 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain SH-B9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2933432..2943572
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UP12_RS14940 (UP12_14955) - 2933694..2934083 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  UP12_RS14945 (UP12_14960) comA 2934107..2934748 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  UP12_RS14950 (UP12_14965) comP 2934829..2937144 (-) 2316 WP_061409478.1 ATP-binding protein Regulator
  UP12_RS19970 comX 2937202..2937369 (-) 168 WP_081042274.1 competence pheromone ComX -
  UP12_RS14955 (UP12_14970) - 2937366..2938280 (-) 915 WP_061409480.1 polyprenyl synthetase family protein -
  UP12_RS14960 (UP12_14975) degQ 2938432..2938572 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  UP12_RS14965 (UP12_14980) - 2939078..2939431 (+) 354 WP_058013790.1 hypothetical protein -
  UP12_RS14970 (UP12_14985) - 2939463..2940689 (-) 1227 WP_012011110.1 HDOD domain-containing protein -
  UP12_RS14975 (UP12_14990) - 2940829..2942298 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  UP12_RS14980 (UP12_14995) - 2942316..2942867 (-) 552 WP_061409482.1 isochorismatase family cysteine hydrolase -
  UP12_RS14985 (UP12_15000) - 2942928..2943335 (-) 408 WP_061409484.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=141347 UP12_RS14960 WP_003213123.1 2938432..2938572(-) (degQ) [Bacillus pumilus strain SH-B9]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=141347 UP12_RS14960 WP_003213123.1 2938432..2938572(-) (degQ) [Bacillus pumilus strain SH-B9]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment