Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   SB45_RS01865 Genome accession   NZ_CP010556
Coordinates   368249..368368 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain L-H15     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 363249..373368
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB45_RS01850 (SB45_01850) - 364861..365544 (+) 684 WP_015388707.1 response regulator transcription factor -
  SB45_RS01855 (SB45_01855) - 365531..366964 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  SB45_RS01860 (SB45_01860) rapC 367117..368265 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  SB45_RS01865 (SB45_01865) phrC 368249..368368 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  SB45_RS18955 - 368519..368614 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  SB45_RS01870 (SB45_01870) - 368709..370073 (-) 1365 WP_014304341.1 aspartate kinase -
  SB45_RS01875 (SB45_01875) ceuB 370488..371441 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  SB45_RS01880 (SB45_01880) - 371431..372378 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  SB45_RS01885 (SB45_01885) - 372372..373130 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=139231 SB45_RS01865 WP_003156334.1 368249..368368(+) (phrC) [Bacillus velezensis strain L-H15]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=139231 SB45_RS01865 WP_003156334.1 368249..368368(+) (phrC) [Bacillus velezensis strain L-H15]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment