Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   SC10_RS13475 Genome accession   NZ_CP010524
Coordinates   2731038..2731214 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain BL-09     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2726038..2736214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SC10_RS13455 (SC10_B2orf04077) gcvT 2726678..2727772 (-) 1095 WP_035338369.1 glycine cleavage system aminomethyltransferase GcvT -
  SC10_RS13465 (SC10_B2orf04079) - 2728367..2730046 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  SC10_RS13470 (SC10_B2orf04080) - 2730053..2730847 (+) 795 WP_020452164.1 YqhG family protein -
  SC10_RS13475 (SC10_B2orf04082) sinI 2731038..2731214 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  SC10_RS13480 (SC10_B2orf04083) sinR 2731248..2731583 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  SC10_RS13485 (SC10_B2orf04085) tasA 2731688..2732482 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  SC10_RS13490 (SC10_B2orf04086) sipW 2732555..2733139 (-) 585 WP_035338370.1 signal peptidase I SipW -
  SC10_RS13495 (SC10_B2orf04089) tapA 2733136..2733864 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  SC10_RS13500 (SC10_B2orf04091) - 2734142..2734462 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  SC10_RS13505 (SC10_B2orf04092) - 2734492..2734674 (-) 183 WP_020452171.1 YqzE family protein -
  SC10_RS13510 (SC10_B2orf04093) comGG 2734763..2735128 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  SC10_RS13515 (SC10_B2orf04094) comGF 2735140..2735622 (-) 483 WP_230588654.1 competence type IV pilus minor pilin ComGF -
  SC10_RS13520 (SC10_B2orf04095) comGE 2735537..2735884 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=138973 SC10_RS13475 WP_023855184.1 2731038..2731214(+) (sinI) [Bacillus paralicheniformis strain BL-09]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=138973 SC10_RS13475 WP_023855184.1 2731038..2731214(+) (sinI) [Bacillus paralicheniformis strain BL-09]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment