Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   SB24_RS17260 Genome accession   NZ_CP010406
Coordinates   3565539..3565712 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus sp. Pc3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3560539..3570712
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB24_RS17210 (SB24_17210) comGD 3560659..3561096 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  SB24_RS17215 (SB24_17215) comGE 3561080..3561394 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  SB24_RS17220 (SB24_17220) comGF 3561303..3561803 (+) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  SB24_RS17225 (SB24_17225) comGG 3561804..3562181 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  SB24_RS17230 (SB24_17230) - 3562238..3562417 (+) 180 WP_003153093.1 YqzE family protein -
  SB24_RS17235 (SB24_17235) - 3562457..3562786 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  SB24_RS17240 (SB24_17240) tapA 3563045..3563716 (+) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  SB24_RS17245 (SB24_17245) - 3563688..3564272 (+) 585 WP_015240205.1 signal peptidase I -
  SB24_RS17250 (SB24_17250) - 3564337..3565122 (+) 786 WP_007408329.1 TasA family protein -
  SB24_RS17255 (SB24_17255) sinR 3565170..3565505 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SB24_RS17260 (SB24_17260) sinI 3565539..3565712 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  SB24_RS17265 (SB24_17265) - 3565889..3566683 (-) 795 WP_007408330.1 YqhG family protein -
  SB24_RS17270 (SB24_17270) - 3566705..3568375 (-) 1671 WP_031378948.1 SNF2-related protein -
  SB24_RS17275 (SB24_17275) gcvT 3568799..3569899 (+) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=136922 SB24_RS17260 WP_003153105.1 3565539..3565712(-) (sinI) [Bacillus sp. Pc3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=136922 SB24_RS17260 WP_003153105.1 3565539..3565712(-) (sinI) [Bacillus sp. Pc3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment