Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   SB24_RS17225 Genome accession   NZ_CP010406
Coordinates   3561804..3562181 (+) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus sp. Pc3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3556804..3567181
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB24_RS17190 (SB24_17190) - 3557119..3558069 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  SB24_RS17195 (SB24_17195) comGA 3558262..3559332 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  SB24_RS17200 (SB24_17200) comGB 3559319..3560356 (+) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  SB24_RS17205 (SB24_17205) comGC 3560403..3560669 (+) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  SB24_RS17210 (SB24_17210) comGD 3560659..3561096 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  SB24_RS17215 (SB24_17215) comGE 3561080..3561394 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  SB24_RS17220 (SB24_17220) comGF 3561303..3561803 (+) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  SB24_RS17225 (SB24_17225) comGG 3561804..3562181 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  SB24_RS17230 (SB24_17230) - 3562238..3562417 (+) 180 WP_003153093.1 YqzE family protein -
  SB24_RS17235 (SB24_17235) - 3562457..3562786 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  SB24_RS17240 (SB24_17240) tapA 3563045..3563716 (+) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  SB24_RS17245 (SB24_17245) - 3563688..3564272 (+) 585 WP_015240205.1 signal peptidase I -
  SB24_RS17250 (SB24_17250) - 3564337..3565122 (+) 786 WP_007408329.1 TasA family protein -
  SB24_RS17255 (SB24_17255) sinR 3565170..3565505 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SB24_RS17260 (SB24_17260) sinI 3565539..3565712 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  SB24_RS17265 (SB24_17265) - 3565889..3566683 (-) 795 WP_007408330.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=136920 SB24_RS17225 WP_015417814.1 3561804..3562181(+) (comGG) [Bacillus sp. Pc3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=136920 SB24_RS17225 WP_015417814.1 3561804..3562181(+) (comGG) [Bacillus sp. Pc3]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment