Detailed information
Overview
| Name | phrF | Type | Regulator |
| Locus tag | RP72_RS20145 | Genome accession | NZ_CP010314 |
| Coordinates | 3826626..3826745 (+) | Length | 39 a.a. |
| NCBI ID | WP_009968329.1 | Uniprot ID | A0A199WEM2 |
| Organism | Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet) | ||
| Function | antagonize RapF (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3821626..3831745
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RP72_RS20120 (RP72_20120) | albG | 3821790..3822491 (+) | 702 | WP_003243391.1 | antilisterial bacteriocin subtilosin biosynthesis protein AlbG | - |
| RP72_RS20125 (RP72_20125) | ywhL | 3822497..3823873 (-) | 1377 | WP_003244415.1 | YncE family protein | - |
| RP72_RS20130 (RP72_20130) | ywhK | 3823912..3825267 (-) | 1356 | WP_003227552.1 | YncE family protein | - |
| RP72_RS23800 (RP72_20135) | - | 3825264..3825494 (-) | 231 | WP_009968328.1 | hypothetical protein | - |
| RP72_RS20140 (RP72_20140) | rapF | 3825497..3826642 (+) | 1146 | WP_003227549.1 | response regulator aspartate phosphatase RapF | Regulator |
| RP72_RS20145 (RP72_20145) | phrF | 3826626..3826745 (+) | 120 | WP_009968329.1 | phosphatase RapF inhibitor PhrF | Regulator |
| RP72_RS20150 (RP72_20150) | ywhH | 3826844..3827317 (+) | 474 | WP_003227547.1 | YbaK/EbsC family protein | - |
| RP72_RS20155 (RP72_20155) | speB | 3827349..3828221 (-) | 873 | WP_003227545.1 | agmatinase | - |
| RP72_RS20160 (RP72_20160) | speE | 3828282..3829112 (-) | 831 | WP_003227543.1 | spermidine synthase | - |
| RP72_RS20165 (RP72_20165) | pbpG | 3829314..3831389 (+) | 2076 | WP_003227540.1 | transglycosylase domain-containing protein | - |
Sequence
Protein
Download Length: 39 a.a. Molecular weight: 4199.10 Da Isoelectric Point: 10.4997
>NTDB_id=136313 RP72_RS20145 WP_009968329.1 3826626..3826745(+) (phrF) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI
Nucleotide
Download Length: 120 bp
>NTDB_id=136313 RP72_RS20145 WP_009968329.1 3826626..3826745(+) (phrF) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| phrF | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |
| phrC | Bacillus subtilis subsp. subtilis str. 168 |
48.718 |
100 |
0.487 |