Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | RP72_RS17155 | Genome accession | NZ_CP010314 |
| Coordinates | 3236586..3236726 (-) | Length | 46 a.a. |
| NCBI ID | WP_003220708.1 | Uniprot ID | G4P060 |
| Organism | Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet) | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3231586..3241726
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RP72_RS17130 (RP72_17130) | yuxO | 3231899..3232279 (-) | 381 | WP_003228810.1 | hotdog fold thioesterase | - |
| RP72_RS17135 (RP72_17135) | comA | 3232298..3232942 (-) | 645 | WP_003220716.1 | two-component system response regulator ComA | Regulator |
| RP72_RS17140 (RP72_17140) | comP | 3233023..3235332 (-) | 2310 | WP_003242894.1 | two-component system sensor histidine kinase ComP | Regulator |
| RP72_RS17145 (RP72_17145) | comX | 3235347..3235514 (-) | 168 | WP_003242801.1 | competence pheromone ComX | Regulator |
| RP72_RS17150 (RP72_17150) | comQ | 3235502..3236401 (-) | 900 | WP_003243039.1 | ComX modifying isoprenyl transferase ComQ | Regulator |
| RP72_RS17155 (RP72_17155) | degQ | 3236586..3236726 (-) | 141 | WP_003220708.1 | degradation enzyme regulation protein DegQ | Regulator |
| RP72_RS23445 | - | 3236948..3237073 (+) | 126 | WP_003228793.1 | hypothetical protein | - |
| RP72_RS17160 (RP72_17160) | - | 3237187..3237555 (+) | 369 | WP_003243784.1 | hypothetical protein | - |
| RP72_RS17165 (RP72_17165) | pdeH | 3237531..3238760 (-) | 1230 | WP_003243525.1 | cyclic di-GMP phosphodiesterase | - |
| RP72_RS17170 (RP72_17170) | pncB | 3238897..3240369 (-) | 1473 | WP_003228788.1 | nicotinate phosphoribosyltransferase | - |
| RP72_RS17175 (RP72_17175) | pncA | 3240385..3240936 (-) | 552 | WP_003243099.1 | isochorismatase family cysteine hydrolase | - |
| RP72_RS17180 (RP72_17180) | yueI | 3241033..3241431 (-) | 399 | WP_003242987.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5546.44 Da Isoelectric Point: 6.2559
>NTDB_id=136302 RP72_RS17155 WP_003220708.1 3236586..3236726(-) (degQ) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=136302 RP72_RS17155 WP_003220708.1 3236586..3236726(-) (degQ) [Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet)]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |