Detailed information    

insolico Bioinformatically predicted

Overview


Name   CJE1441   Type   Regulator
Locus tag   PJ19_RS01800 Genome accession   NZ_CP010072
Coordinates   339994..340647 (-) Length   217 a.a.
NCBI ID   WP_011049930.1    Uniprot ID   A0A3X8NAQ4
Organism   Campylobacter jejuni subsp. jejuni strain 01-1512     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 310121..352636 339994..340647 within 0


Gene organization within MGE regions


Location: 310121..352636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PJ19_RS01640 (PJ19_01640) polA 310121..312760 (-) 2640 WP_002858644.1 DNA polymerase I -
  PJ19_RS01645 (PJ19_01645) - 312924..314285 (+) 1362 WP_043012733.1 MFS transporter -
  PJ19_RS01650 (PJ19_01650) - 314282..315121 (+) 840 WP_043012735.1 nucleoside hydrolase -
  PJ19_RS01655 (PJ19_01655) - 315520..315810 (+) 291 WP_002788257.1 hypothetical protein -
  PJ19_RS01660 (PJ19_01660) - 315797..316138 (+) 342 WP_002788260.1 HNH endonuclease signature motif containing protein -
  PJ19_RS01665 (PJ19_01665) - 316398..317033 (+) 636 WP_011049939.1 P27 family phage terminase small subunit -
  PJ19_RS01670 (PJ19_01670) - 317037..318662 (+) 1626 WP_011049938.1 terminase TerL endonuclease subunit -
  PJ19_RS01675 (PJ19_01675) - 318717..319151 (+) 435 WP_002788265.1 type II toxin-antitoxin system PemK/MazF family toxin -
  PJ19_RS01680 (PJ19_01680) - 319311..320483 (+) 1173 WP_002788272.1 phage portal protein -
  PJ19_RS01685 (PJ19_01685) - 320480..321022 (+) 543 WP_002800770.1 HK97 gp10 family phage protein -
  PJ19_RS01690 (PJ19_01690) - 321023..321373 (+) 351 WP_002788276.1 hypothetical protein -
  PJ19_RS01695 (PJ19_01695) - 321545..322525 (+) 981 WP_002800772.1 hypothetical protein -
  PJ19_RS01700 (PJ19_01700) - 322522..322878 (+) 357 WP_002788281.1 hypothetical protein -
  PJ19_RS01705 (PJ19_01705) - 322959..323174 (+) 216 WP_002788282.1 hypothetical protein -
  PJ19_RS01710 (PJ19_01710) - 323166..323504 (-) 339 WP_043012736.1 hypothetical protein -
  PJ19_RS01715 (PJ19_01715) - 323564..329290 (+) 5727 WP_002800774.1 hypothetical protein -
  PJ19_RS01720 (PJ19_01720) - 329303..330172 (+) 870 WP_002788286.1 hypothetical protein -
  PJ19_RS01725 (PJ19_01725) - 330258..330815 (+) 558 WP_002788287.1 HK97 family phage prohead protease -
  PJ19_RS01730 (PJ19_01730) - 330832..331998 (+) 1167 WP_002788288.1 phage major capsid protein -
  PJ19_RS01735 (PJ19_01735) - 332009..332260 (+) 252 WP_002788291.1 hypothetical protein -
  PJ19_RS01740 (PJ19_01740) - 332257..332694 (+) 438 WP_002788293.1 phage gp6-like head-tail connector protein -
  PJ19_RS01745 (PJ19_01745) - 332707..333024 (+) 318 WP_002788295.1 head-tail adaptor protein -
  PJ19_RS01750 (PJ19_01750) - 333021..333653 (+) 633 WP_002788297.1 hypothetical protein -
  PJ19_RS01755 (PJ19_01755) - 333646..335211 (+) 1566 WP_002858267.1 hypothetical protein -
  PJ19_RS01760 (PJ19_01760) - 335213..335662 (+) 450 WP_043012737.1 hypothetical protein -
  PJ19_RS01765 (PJ19_01765) - 335675..336310 (+) 636 WP_002789149.1 DUF4376 domain-containing protein -
  PJ19_RS01770 (PJ19_01770) - 336307..336771 (+) 465 WP_002801917.1 hypothetical protein -
  PJ19_RS01775 (PJ19_01775) - 336761..337132 (+) 372 WP_002801918.1 DUF1353 domain-containing protein -
  PJ19_RS01780 (PJ19_01780) - 337129..338412 (+) 1284 WP_002801920.1 hypothetical protein -
  PJ19_RS01785 (PJ19_01785) - 338461..338919 (+) 459 WP_043012738.1 DUF5675 family protein -
  PJ19_RS01790 (PJ19_01790) - 339148..339567 (+) 420 WP_002870261.1 hypothetical protein -
  PJ19_RS09910 - 339485..339682 (+) 198 WP_002913413.1 hypothetical protein -
  PJ19_RS01795 (PJ19_01795) - 339696..339977 (-) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  PJ19_RS01800 (PJ19_01800) CJE1441 339994..340647 (-) 654 WP_011049930.1 DNA/RNA non-specific endonuclease Regulator
  PJ19_RS01805 (PJ19_01805) - 340653..341315 (-) 663 WP_002870274.1 S24/S26 family peptidase -
  PJ19_RS01810 (PJ19_01810) - 341550..342203 (-) 654 WP_002870336.1 hypothetical protein -
  PJ19_RS01815 (PJ19_01815) - 342407..342610 (+) 204 WP_002858450.1 hypothetical protein -
  PJ19_RS01820 (PJ19_01820) - 342607..342891 (+) 285 WP_002788580.1 hypothetical protein -
  PJ19_RS01825 (PJ19_01825) - 343322..344053 (+) 732 WP_002801548.1 phage regulatory protein/antirepressor Ant -
  PJ19_RS01830 (PJ19_01830) - 344106..344393 (+) 288 WP_002787279.1 YopX family protein -
  PJ19_RS01835 (PJ19_01835) - 344450..344713 (+) 264 WP_002787281.1 hypothetical protein -
  PJ19_RS01840 (PJ19_01840) - 344679..344909 (+) 231 WP_002787283.1 hypothetical protein -
  PJ19_RS01845 (PJ19_01845) - 345047..345814 (+) 768 WP_002787287.1 hypothetical protein -
  PJ19_RS01850 (PJ19_01850) - 345828..346064 (+) 237 WP_002787289.1 hypothetical protein -
  PJ19_RS01855 (PJ19_01855) - 346452..346772 (+) 321 WP_002787293.1 hypothetical protein -
  PJ19_RS01860 (PJ19_01860) - 346851..347165 (+) 315 WP_002787295.1 hypothetical protein -
  PJ19_RS01865 (PJ19_01865) - 347102..347863 (+) 762 WP_002787298.1 hypothetical protein -
  PJ19_RS01870 (PJ19_01870) - 347872..348096 (+) 225 WP_002787300.1 hypothetical protein -
  PJ19_RS01875 (PJ19_01875) - 348097..348468 (+) 372 WP_002858334.1 hypothetical protein -
  PJ19_RS01880 (PJ19_01880) - 348452..348718 (+) 267 WP_002787304.1 hypothetical protein -
  PJ19_RS01885 (PJ19_01885) - 348696..349451 (+) 756 WP_043012739.1 site-specific DNA-methyltransferase -
  PJ19_RS01890 (PJ19_01890) - 349557..349793 (+) 237 WP_043012740.1 helix-turn-helix transcriptional regulator -
  PJ19_RS01895 (PJ19_01895) - 350169..350906 (+) 738 WP_043012741.1 Rha family transcriptional regulator -
  PJ19_RS01900 (PJ19_01900) - 350903..351256 (+) 354 WP_043012742.1 hypothetical protein -
  PJ19_RS01905 (PJ19_01905) - 351258..351464 (+) 207 WP_043012743.1 helix-turn-helix domain-containing protein -
  PJ19_RS01910 (PJ19_01910) - 351461..352636 (-) 1176 WP_002787311.1 site-specific integrase -

Sequence


Protein


Download         Length: 217 a.a.        Molecular weight: 25531.02 Da        Isoelectric Point: 9.8742

>NTDB_id=133994 PJ19_RS01800 WP_011049930.1 339994..340647(-) (CJE1441) [Campylobacter jejuni subsp. jejuni strain 01-1512]
MKKLIILSLLSTLAFADYTQYKPSEDFAKYFTKQNCSQVLDKFYYINCYDYSLKGTKAVAYRLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDNNPQRIKNNIAIPSSYTKILKGDNFKECYQVPNHDVENENLRIYKVKCDNF

Nucleotide


Download         Length: 654 bp        

>NTDB_id=133994 PJ19_RS01800 WP_011049930.1 339994..340647(-) (CJE1441) [Campylobacter jejuni subsp. jejuni strain 01-1512]
ATGAAAAAACTTATAATCTTATCTTTATTATCCACTCTAGCTTTTGCTGATTATACACAATACAAACCAAGCGAAGATTT
TGCCAAGTATTTTACTAAACAAAACTGCTCACAAGTTTTGGATAAATTTTATTATATTAATTGTTATGATTATTCTTTAA
AAGGCACTAAAGCCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATTCCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTACGACAGGGGACACACTCT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAACATTACTCCACAAAATCCAC
AAATCAATCAAAGAGTTTGGAATAAAATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGACAATAATCCACAAAGAATAAAAAACAATATTGCTATTCCAAGCTCTTACACTAAGATTTTAAA
AGGTGATAATTTTAAAGAATGTTACCAAGTGCCTAATCACGATGTAGAAAATGAGAATTTAAGAATATATAAAGTAAAAT
GTGACAATTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A3X8NAQ4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

100

100

1

  CJE0566 Campylobacter jejuni RM1221

91.163

99.078

0.903


Multiple sequence alignment