Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QX56_RS12780 Genome accession   NZ_CP010053
Coordinates   2552227..2552400 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain PS832     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547227..2557400
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QX56_RS12765 (QX56_13410) gcvT 2548026..2549114 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  QX56_RS12770 (QX56_13415) hepAA 2549556..2551229 (+) 1674 WP_004398544.1 SNF2-related protein -
  QX56_RS12775 (QX56_13420) yqhG 2551250..2552044 (+) 795 WP_003230200.1 YqhG family protein -
  QX56_RS12780 (QX56_13425) sinI 2552227..2552400 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QX56_RS12785 (QX56_13430) sinR 2552434..2552769 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QX56_RS12790 (QX56_13435) tasA 2552862..2553647 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  QX56_RS12795 (QX56_13440) sipW 2553711..2554283 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QX56_RS12800 (QX56_13445) tapA 2554267..2555028 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QX56_RS12805 (QX56_13450) yqzG 2555300..2555626 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QX56_RS12810 (QX56_13455) spoIITA 2555668..2555847 (-) 180 WP_003230176.1 YqzE family protein -
  QX56_RS12815 (QX56_13460) comGG 2555918..2556292 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QX56_RS12820 (QX56_13465) comGF 2556293..2556676 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QX56_RS12825 (QX56_13470) comGE 2556702..2557049 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=133876 QX56_RS12780 WP_003230187.1 2552227..2552400(+) (sinI) [Bacillus subtilis strain PS832]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=133876 QX56_RS12780 WP_003230187.1 2552227..2552400(+) (sinI) [Bacillus subtilis strain PS832]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment