Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QX56_RS12820 Genome accession   NZ_CP010053
Coordinates   2556293..2556676 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain PS832     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551293..2561676
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QX56_RS12780 (QX56_13425) sinI 2552227..2552400 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QX56_RS12785 (QX56_13430) sinR 2552434..2552769 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QX56_RS12790 (QX56_13435) tasA 2552862..2553647 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  QX56_RS12795 (QX56_13440) sipW 2553711..2554283 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QX56_RS12800 (QX56_13445) tapA 2554267..2555028 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QX56_RS12805 (QX56_13450) yqzG 2555300..2555626 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QX56_RS12810 (QX56_13455) spoIITA 2555668..2555847 (-) 180 WP_003230176.1 YqzE family protein -
  QX56_RS12815 (QX56_13460) comGG 2555918..2556292 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QX56_RS12820 (QX56_13465) comGF 2556293..2556676 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QX56_RS12825 (QX56_13470) comGE 2556702..2557049 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QX56_RS12830 (QX56_13475) comGD 2557033..2557464 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QX56_RS12835 (QX56_13480) comGC 2557454..2557750 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QX56_RS12840 (QX56_13485) comGB 2557764..2558801 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  QX56_RS12845 (QX56_13490) comGA 2558788..2559858 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QX56_RS12850 (QX56_13500) corA 2560270..2561223 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=133879 QX56_RS12820 WP_003230168.1 2556293..2556676(-) (comGF) [Bacillus subtilis strain PS832]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=133879 QX56_RS12820 WP_003230168.1 2556293..2556676(-) (comGF) [Bacillus subtilis strain PS832]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment