Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QF06_RS14190 Genome accession   NZ_CP010014
Coordinates   2870447..2870587 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. YP1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2865447..2875587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QF06_RS14165 (QF06_14165) - 2865790..2866170 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  QF06_RS14170 (QF06_14170) comA 2866189..2866833 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QF06_RS14175 (QF06_14175) comP 2866914..2869214 (-) 2301 WP_043940185.1 histidine kinase Regulator
  QF06_RS14180 (QF06_14180) comX 2869226..2869390 (-) 165 WP_015384519.1 competence pheromone ComX -
  QF06_RS14185 (QF06_14185) - 2869403..2870263 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  QF06_RS14190 (QF06_14190) degQ 2870447..2870587 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QF06_RS22165 - 2870809..2870871 (+) 63 Protein_2889 hypothetical protein -
  QF06_RS14195 (QF06_14195) - 2871050..2871418 (+) 369 WP_041850584.1 hypothetical protein -
  QF06_RS14200 (QF06_14200) pdeH 2871394..2872630 (-) 1237 Protein_2891 cyclic di-GMP phosphodiesterase -
  QF06_RS14205 (QF06_14205) - 2872767..2874239 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QF06_RS14210 (QF06_14210) - 2874255..2874806 (-) 552 WP_043940186.1 isochorismatase family cysteine hydrolase -
  QF06_RS14215 (QF06_14215) - 2874903..2875301 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=133585 QF06_RS14190 WP_003220708.1 2870447..2870587(-) (degQ) [Bacillus sp. YP1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=133585 QF06_RS14190 WP_003220708.1 2870447..2870587(-) (degQ) [Bacillus sp. YP1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment