Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | OY17_RS14735 | Genome accession | NZ_CP009938 |
| Coordinates | 3071551..3071724 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus sp. BH072 isolate honey | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3066551..3076724
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OY17_RS14720 (OY17_14720) | gcvT | 3067364..3068464 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| OY17_RS14725 (OY17_14725) | - | 3068888..3070558 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| OY17_RS14730 (OY17_14730) | - | 3070580..3071374 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| OY17_RS14735 (OY17_14735) | sinI | 3071551..3071724 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| OY17_RS14740 (OY17_14740) | sinR | 3071758..3072093 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| OY17_RS14745 (OY17_14745) | - | 3072141..3072926 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| OY17_RS14750 (OY17_14750) | - | 3072991..3073575 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| OY17_RS14755 (OY17_14755) | tapA | 3073547..3074218 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| OY17_RS14760 (OY17_14760) | - | 3074477..3074806 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| OY17_RS14765 (OY17_14765) | - | 3074847..3075026 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| OY17_RS14770 (OY17_14770) | comGG | 3075083..3075460 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| OY17_RS14775 (OY17_14775) | comGF | 3075461..3075856 (-) | 396 | WP_014721501.1 | competence type IV pilus minor pilin ComGF | - |
| OY17_RS14780 (OY17_14780) | comGE | 3075870..3076184 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| OY17_RS14785 (OY17_14785) | comGD | 3076168..3076605 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=133155 OY17_RS14735 WP_014418369.1 3071551..3071724(+) (sinI) [Bacillus sp. BH072 isolate honey]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=133155 OY17_RS14735 WP_014418369.1 3071551..3071724(+) (sinI) [Bacillus sp. BH072 isolate honey]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |