Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   OY17_RS14780 Genome accession   NZ_CP009938
Coordinates   3075870..3076184 (-) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus sp. BH072 isolate honey     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3070870..3081184
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OY17_RS14735 (OY17_14735) sinI 3071551..3071724 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  OY17_RS14740 (OY17_14740) sinR 3071758..3072093 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OY17_RS14745 (OY17_14745) - 3072141..3072926 (-) 786 WP_007408329.1 TasA family protein -
  OY17_RS14750 (OY17_14750) - 3072991..3073575 (-) 585 WP_014418370.1 signal peptidase I -
  OY17_RS14755 (OY17_14755) tapA 3073547..3074218 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  OY17_RS14760 (OY17_14760) - 3074477..3074806 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  OY17_RS14765 (OY17_14765) - 3074847..3075026 (-) 180 WP_003153093.1 YqzE family protein -
  OY17_RS14770 (OY17_14770) comGG 3075083..3075460 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  OY17_RS14775 (OY17_14775) comGF 3075461..3075856 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  OY17_RS14780 (OY17_14780) comGE 3075870..3076184 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  OY17_RS14785 (OY17_14785) comGD 3076168..3076605 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OY17_RS14790 (OY17_14790) comGC 3076595..3076903 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  OY17_RS14795 (OY17_14795) comGB 3076908..3077945 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  OY17_RS14800 (OY17_14800) comGA 3077932..3079002 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  OY17_RS14805 (OY17_14805) - 3079195..3080145 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=133158 OY17_RS14780 WP_032863566.1 3075870..3076184(-) (comGE) [Bacillus sp. BH072 isolate honey]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=133158 OY17_RS14780 WP_032863566.1 3075870..3076184(-) (comGE) [Bacillus sp. BH072 isolate honey]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49

Multiple sequence alignment