Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   OY17_RS04660 Genome accession   NZ_CP009938
Coordinates   939703..939822 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus sp. BH072 isolate honey     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 934703..944822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OY17_RS04645 (OY17_04645) - 936315..936998 (+) 684 WP_014416901.1 response regulator transcription factor -
  OY17_RS04650 (OY17_04650) - 936985..938412 (+) 1428 WP_088056326.1 HAMP domain-containing sensor histidine kinase -
  OY17_RS04655 (OY17_04655) rapC 938571..939719 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  OY17_RS04660 (OY17_04660) phrC 939703..939822 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  OY17_RS19840 (OY17_04665) - 939973..940068 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  OY17_RS04670 (OY17_04670) - 940163..941527 (-) 1365 WP_014416903.1 aspartate kinase -
  OY17_RS04675 (OY17_04675) ceuB 941941..942894 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  OY17_RS04680 (OY17_04680) - 942884..943831 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  OY17_RS04685 (OY17_04685) - 943825..944583 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=133126 OY17_RS04660 WP_003156334.1 939703..939822(+) (phrC) [Bacillus sp. BH072 isolate honey]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=133126 OY17_RS04660 WP_003156334.1 939703..939822(+) (phrC) [Bacillus sp. BH072 isolate honey]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment