Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   OB04_RS16215 Genome accession   NZ_CP009796
Coordinates   3114394..3114534 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SG6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3109394..3119534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OB04_RS16190 (OB04_03179) yuxO 3109671..3110051 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  OB04_RS16195 (OB04_03180) comA 3110070..3110714 (-) 645 WP_038429541.1 two-component system response regulator ComA Regulator
  OB04_RS16200 (OB04_03181) comP 3110795..3113107 (-) 2313 WP_032722435.1 histidine kinase Regulator
  OB04_RS16205 (OB04_03182) comX 3113123..3113344 (-) 222 WP_014480704.1 competence pheromone ComX -
  OB04_RS16210 (OB04_03183) - 3113346..3114209 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  OB04_RS16215 (OB04_03184) degQ 3114394..3114534 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OB04_RS22335 - 3114756..3114881 (+) 126 WP_003228793.1 hypothetical protein -
  OB04_RS16220 (OB04_03185) - 3114995..3115363 (+) 369 WP_014477834.1 hypothetical protein -
  OB04_RS16225 (OB04_03186) pdeH 3115339..3116568 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  OB04_RS16230 (OB04_03187) pncB 3116705..3118177 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  OB04_RS16235 (OB04_03188) pncA 3118193..3118744 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  OB04_RS16240 (OB04_03189) yueI 3118841..3119239 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=132360 OB04_RS16215 WP_003220708.1 3114394..3114534(-) (degQ) [Bacillus subtilis strain SG6]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=132360 OB04_RS16215 WP_003220708.1 3114394..3114534(-) (degQ) [Bacillus subtilis strain SG6]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment