Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ID12_RS00565 Genome accession   NZ_CP009108
Coordinates   99053..99193 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain GR-8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 94053..104193
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ID12_RS00540 (ID12_00565) - 94375..94764 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  ID12_RS00545 (ID12_00570) comA 94788..95429 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  ID12_RS00550 (ID12_00575) comP 95510..97816 (-) 2307 WP_017358942.1 ATP-binding protein Regulator
  ID12_RS00555 (ID12_00580) comX 97830..98000 (-) 171 WP_017358941.1 competence pheromone ComX -
  ID12_RS00560 (ID12_00585) - 97978..98901 (-) 924 WP_017358940.1 polyprenyl synthetase family protein -
  ID12_RS00565 (ID12_00590) degQ 99053..99193 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ID12_RS00570 (ID12_00595) - 99699..100055 (+) 357 WP_050826564.1 hypothetical protein -
  ID12_RS00575 (ID12_00600) - 100092..101318 (-) 1227 WP_050826565.1 EAL and HDOD domain-containing protein -
  ID12_RS00580 (ID12_00605) - 101460..102929 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  ID12_RS00585 (ID12_00610) - 102947..103498 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  ID12_RS00590 (ID12_00615) - 103559..103966 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=126833 ID12_RS00565 WP_003213123.1 99053..99193(-) (degQ) [Bacillus altitudinis strain GR-8]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=126833 ID12_RS00565 WP_003213123.1 99053..99193(-) (degQ) [Bacillus altitudinis strain GR-8]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment