Detailed information NTG0126673

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: SMQ301_RS08960
• Genome accession: NZ_CP011217
• Coordinates: 1716158..1716475 (-)
• Length: 105 a.a.
• NCBI ID: WP_011681685.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain SMQ-301
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1711158..1721475

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMQ301_RS08925 (SMQ301_1858)	-	1711517..1712179 (-)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-
SMQ301_RS08930 (SMQ301_1859)	-	1712276..1712719 (-)	444	WP_011681680.1	hypothetical protein	-
SMQ301_RS12620 (SMQ301_1860)	-	1712793..1713131 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
SMQ301_RS12625 (SMQ301_1861)	-	1713175..1713450 (-)	276	WP_011681681.1	hypothetical protein	-
SMQ301_RS08945 (SMQ301_1862)	-	1713462..1713659 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
SMQ301_RS08950 (SMQ301_1863)	-	1713908..1715101 (-)	1194	WP_014608740.1	acetate kinase	-
SMQ301_RS08955 (SMQ301_1864)	comGH	1715157..1716113 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
SMQ301_RS08960 (SMQ301_1865)	comGG	1716158..1716475 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
SMQ301_RS08965 (SMQ301_1866)	comGF	1716453..1716890 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
SMQ301_RS08970	comGE	1716874..1717167 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
SMQ301_RS08975 (SMQ301_1868)	comGD	1717139..1717567 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
SMQ301_RS08980 (SMQ301_1869)	comGC	1717527..1717853 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
SMQ301_RS08985 (SMQ301_1870)	comGB	1717850..1718950 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
SMQ301_RS08990 (SMQ301_1871)	comGA	1718832..1719773 (-)	942	WP_014622005.1	competence type IV pilus ATPase ComGA	Machinery gene
SMQ301_RS08995 (SMQ301_1872)	-	1719854..1720216 (-)	363	WP_023909982.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11851.01 Da
• Isoelectric Point: 10.6334

>NTDB_id=126673 SMQ301_RS08960 WP_011681685.1 1716158..1716475(-) (comGG) [Streptococcus thermophilus strain SMQ-301]
MLLKKQVRGGVLLYALFMAGIFILLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVVVRVVSKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=126673 SMQ301_RS08960 WP_011681685.1 1716158..1716475(-) (comGG) [Streptococcus thermophilus strain SMQ-301]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTATACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGGTTGTCAGAGTTGTCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae TIGR4	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae D39	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae R6	43.333	85.714	0.371
comGG/cglG	Streptococcus mitis NCTC 12261	42.222	85.714	0.362