Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   O7A_RS17255 Genome accession   NZ_CP011115
Coordinates   3255854..3256021 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250854..3261021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O7A_RS17225 (O7A_17225) mrpE 3251250..3251726 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  O7A_RS17230 (O7A_17230) mrpF 3251726..3252010 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  O7A_RS17235 (O7A_17235) mnhG 3251994..3252368 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  O7A_RS17240 (O7A_17240) yuxO 3252407..3252787 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  O7A_RS17245 (O7A_17245) comA 3252806..3253450 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  O7A_RS17250 (O7A_17250) comP 3253531..3255839 (-) 2309 Protein_3326 two-component system sensor histidine kinase ComP -
  O7A_RS17255 (O7A_17255) comX 3255854..3256021 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  O7A_RS17260 (O7A_17260) comQ 3256009..3256908 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  O7A_RS17265 (O7A_17265) degQ 3257093..3257233 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  O7A_RS23565 - 3257455..3257580 (+) 126 WP_003228793.1 hypothetical protein -
  O7A_RS17270 (O7A_17270) - 3257694..3258062 (+) 369 WP_003243784.1 hypothetical protein -
  O7A_RS17275 (O7A_17275) pdeH 3258038..3259267 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  O7A_RS17280 (O7A_17280) pncB 3259404..3260876 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=126302 O7A_RS17255 WP_003242801.1 3255854..3256021(-) (comX) [Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=126302 O7A_RS17255 WP_003242801.1 3255854..3256021(-) (comX) [Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment