Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   BSUA_RS13370 Genome accession   NZ_CP007800
Coordinates   2525419..2525754 (+) Length   111 a.a.
NCBI ID   WP_003226345.1    Uniprot ID   A0AAE2VGU9
Organism   Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Genomic Context

Location: 2520419..2530754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUA_RS13350 (BSUA_02632) gcvT 2521011..2522099 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  BSUA_RS13355 (BSUA_02633) hepAA 2522541..2524214 (+) 1674 WP_004398544.1 SNF2-related protein -
  BSUA_RS13360 (BSUA_02634) yqhG 2524235..2525029 (+) 795 WP_003230200.1 YqhG family protein -
  BSUA_RS13365 (BSUA_02635) sinI 2525212..2525385 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSUA_RS13370 (BSUA_02636) sinR 2525419..2525754 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSUA_RS13375 (BSUA_02637) tasA 2525847..2526632 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BSUA_RS13380 (BSUA_02638) sipW 2526696..2527268 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BSUA_RS13385 (BSUA_02639) tapA 2527252..2528013 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BSUA_RS13390 (BSUA_02640) yqzG 2528285..2528611 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSUA_RS13395 (BSUA_02641) spoIITA 2528653..2528832 (-) 180 WP_003230176.1 YqzE family protein -
  BSUA_RS13400 (BSUA_02642) comGG 2528903..2529277 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BSUA_RS13405 (BSUA_02643) comGF 2529278..2529661 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BSUA_RS13410 (BSUA_02644) comGE 2529687..2530034 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  BSUA_RS13415 (BSUA_02645) comGD 2530018..2530449 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  BSUA_RS13420 (BSUA_02646) comGC 2530439..2530735 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene

Sequence

Protein


Download         Length: 111 a.a.        Molecular weight: 12988.64 Da        Isoelectric Point: 7.2023

>NTDB_id=123410 BSUA_RS13370 WP_003226345.1 2525419..2525754(+) (sinR) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEK
LVRDAMTSGVSKKQFREFLDYQKWRKSQKEE

Nucleotide


Download         Length: 336 bp        

>NTDB_id=123410 BSUA_RS13370 WP_003226345.1 2525419..2525754(+) (sinR) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
TTGATTGGCCAGCGTATTAAACAATACCGTAAAGAAAAAGGCTACTCACTATCAGAACTAGCTGAAAAAGCTGGGGTAGC
GAAGTCTTATTTAAGCTCAATAGAACGAAATCTACAAACGAACCCCTCCATTCAATTTCTCGAAAAAGTCTCCGCTGTTC
TGGACGTCTCGGTTCATACTTTGCTCGATGAGAAACATGAAACCGAATACGATGGTCAATTAGATAGTGAATGGGAGAAA
TTGGTTCGCGATGCGATGACATCCGGGGTATCGAAAAAACAATTTCGTGAATTTTTAGATTATCAAAAATGGAGAAAATC
CCAAAAAGAGGAGTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(6-58)

Anti-repressor SinI (SinI)

(74-101)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment