Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSUA_RS13365 | Genome accession | NZ_CP007800 |
| Coordinates | 2525212..2525385 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2520212..2530385
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSUA_RS13350 (BSUA_02632) | gcvT | 2521011..2522099 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BSUA_RS13355 (BSUA_02633) | hepAA | 2522541..2524214 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| BSUA_RS13360 (BSUA_02634) | yqhG | 2524235..2525029 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| BSUA_RS13365 (BSUA_02635) | sinI | 2525212..2525385 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| BSUA_RS13370 (BSUA_02636) | sinR | 2525419..2525754 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BSUA_RS13375 (BSUA_02637) | tasA | 2525847..2526632 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| BSUA_RS13380 (BSUA_02638) | sipW | 2526696..2527268 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| BSUA_RS13385 (BSUA_02639) | tapA | 2527252..2528013 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSUA_RS13390 (BSUA_02640) | yqzG | 2528285..2528611 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BSUA_RS13395 (BSUA_02641) | spoIITA | 2528653..2528832 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| BSUA_RS13400 (BSUA_02642) | comGG | 2528903..2529277 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| BSUA_RS13405 (BSUA_02643) | comGF | 2529278..2529661 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| BSUA_RS13410 (BSUA_02644) | comGE | 2529687..2530034 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=123409 BSUA_RS13365 WP_003230187.1 2525212..2525385(+) (sinI) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=123409 BSUA_RS13365 WP_003230187.1 2525212..2525385(+) (sinI) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |