Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | ayp1020_RS01400 | Genome accession | NZ_CP007601 |
| Coordinates | 286200..286775 (+) | Length | 191 a.a. |
| NCBI ID | WP_002433165.1 | Uniprot ID | - |
| Organism | Staphylococcus capitis subsp. capitis strain AYP1020 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 287282..335640 | 286200..286775 | flank | 507 |
Gene organization within MGE regions
Location: 286200..335640
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ayp1020_RS01400 (AYP1020_0286) | comK/comK1 | 286200..286775 (+) | 576 | WP_002433165.1 | competence protein ComK | Regulator |
| ayp1020_RS11975 (AYP1020_0289) | - | 287282..288343 (-) | 1062 | WP_053035554.1 | tyrosine-type recombinase/integrase | - |
| ayp1020_RS01425 (AYP1020_0290) | - | 288398..289402 (-) | 1005 | WP_047796045.1 | restriction endonuclease subunit S | - |
| ayp1020_RS01430 (AYP1020_0291) | - | 289386..291290 (-) | 1905 | WP_047796046.1 | HsdM family class I SAM-dependent methyltransferase | - |
| ayp1020_RS01435 (AYP1020_0292) | - | 291313..291777 (-) | 465 | WP_047796047.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ayp1020_RS01440 (AYP1020_0293) | - | 291792..292124 (-) | 333 | WP_047796048.1 | helix-turn-helix domain-containing protein | - |
| ayp1020_RS01445 (AYP1020_0294) | - | 292301..292543 (+) | 243 | WP_047796049.1 | helix-turn-helix domain-containing protein | - |
| ayp1020_RS01450 (AYP1020_0295) | - | 292559..293518 (+) | 960 | WP_047796050.1 | ParB N-terminal domain-containing protein | - |
| ayp1020_RS11980 (AYP1020_0296) | - | 293515..294285 (+) | 771 | WP_053035555.1 | DUF6551 family protein | - |
| ayp1020_RS12380 (AYP1020_0297) | - | 294349..294498 (+) | 150 | WP_169922989.1 | hypothetical protein | - |
| ayp1020_RS01460 (AYP1020_0298) | - | 294484..294690 (-) | 207 | WP_047796051.1 | hypothetical protein | - |
| ayp1020_RS01465 (AYP1020_0299) | - | 294779..295018 (+) | 240 | WP_047796052.1 | Thoeris anti-defense Tad2 family protein | - |
| ayp1020_RS12385 (AYP1020_0300) | - | 295105..295272 (+) | 168 | WP_169922990.1 | hypothetical protein | - |
| ayp1020_RS01470 (AYP1020_0301) | - | 295276..295488 (+) | 213 | WP_002436465.1 | DUF771 domain-containing protein | - |
| ayp1020_RS01475 (AYP1020_0303) | - | 295572..295871 (-) | 300 | WP_002436480.1 | hypothetical protein | - |
| ayp1020_RS01480 (AYP1020_0304) | - | 295963..296181 (+) | 219 | WP_047796053.1 | hypothetical protein | - |
| ayp1020_RS01485 (AYP1020_0305) | - | 296203..296485 (+) | 283 | Protein_299 | chordopoxvirus fusion protein | - |
| ayp1020_RS01490 (AYP1020_0306) | - | 296451..296672 (+) | 222 | WP_047796055.1 | DUF2483 family protein | - |
| ayp1020_RS01495 (AYP1020_0307) | - | 296665..297291 (+) | 627 | WP_047796056.1 | DUF1071 domain-containing protein | - |
| ayp1020_RS01500 (AYP1020_0308) | - | 297284..297700 (+) | 417 | WP_047796057.1 | single-stranded DNA-binding protein | - |
| ayp1020_RS01505 (AYP1020_0309) | - | 297714..298388 (+) | 675 | WP_047796058.1 | putative HNHc nuclease | - |
| ayp1020_RS01510 (AYP1020_0310) | - | 298385..298672 (+) | 288 | WP_047796059.1 | winged helix-turn-helix transcriptional regulator | - |
| ayp1020_RS01515 (AYP1020_0311) | - | 298678..299463 (+) | 786 | WP_047796060.1 | conserved phage C-terminal domain-containing protein | - |
| ayp1020_RS01520 (AYP1020_0312) | - | 299483..300244 (+) | 762 | WP_369952416.1 | ATP-binding protein | - |
| ayp1020_RS12390 (AYP1020_0313) | - | 300238..300393 (+) | 156 | WP_047796062.1 | hypothetical protein | - |
| ayp1020_RS01530 (AYP1020_0314) | - | 300396..300641 (+) | 246 | WP_047796063.1 | hypothetical protein | - |
| ayp1020_RS01535 (AYP1020_0315) | - | 300650..301060 (+) | 411 | WP_047796064.1 | DUF1064 domain-containing protein | - |
| ayp1020_RS01540 (AYP1020_0316) | - | 301050..301238 (+) | 189 | WP_047796065.1 | hypothetical protein | - |
| ayp1020_RS01545 (AYP1020_0317) | - | 301239..301589 (+) | 351 | WP_047796066.1 | SA1788 family PVL leukocidin-associated protein | - |
| ayp1020_RS01550 (AYP1020_0318) | - | 301707..302024 (+) | 318 | WP_047796067.1 | MazG-like family protein | - |
| ayp1020_RS01555 (AYP1020_0319) | - | 302017..302844 (+) | 828 | WP_047796068.1 | hypothetical protein | - |
| ayp1020_RS01560 (AYP1020_0320) | rinB | 302850..303020 (+) | 171 | WP_047796069.1 | transcriptional activator RinB | - |
| ayp1020_RS01565 (AYP1020_0321) | - | 303091..303507 (+) | 417 | WP_002436508.1 | hypothetical protein | - |
| ayp1020_RS01570 (AYP1020_0322) | - | 303764..304201 (+) | 438 | WP_037579395.1 | terminase small subunit | - |
| ayp1020_RS01575 (AYP1020_0323) | - | 304188..305468 (+) | 1281 | WP_047796070.1 | PBSX family phage terminase large subunit | - |
| ayp1020_RS01580 (AYP1020_0324) | - | 305482..306978 (+) | 1497 | WP_047796071.1 | phage portal protein | - |
| ayp1020_RS01585 (AYP1020_0325) | - | 306985..307935 (+) | 951 | WP_047796072.1 | minor capsid protein | - |
| ayp1020_RS01590 (AYP1020_0326) | - | 307955..308500 (+) | 546 | WP_047796073.1 | hypothetical protein | - |
| ayp1020_RS12395 (AYP1020_0327) | - | 308493..308636 (+) | 144 | WP_169922991.1 | hypothetical protein | - |
| ayp1020_RS01595 (AYP1020_0328) | - | 308890..309495 (+) | 606 | WP_047796074.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| ayp1020_RS01600 (AYP1020_0329) | - | 309511..310425 (+) | 915 | WP_047796075.1 | phage major capsid protein | - |
| ayp1020_RS01605 (AYP1020_0330) | - | 310448..310717 (+) | 270 | WP_047796076.1 | hypothetical protein | - |
| ayp1020_RS01610 (AYP1020_0331) | - | 310719..311048 (+) | 330 | WP_002436519.1 | phage head-tail connector protein | - |
| ayp1020_RS01615 (AYP1020_0332) | - | 311045..311347 (+) | 303 | WP_047796077.1 | hypothetical protein | - |
| ayp1020_RS01620 (AYP1020_0333) | - | 311347..311706 (+) | 360 | WP_047796078.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ayp1020_RS01625 (AYP1020_0334) | - | 311717..312106 (+) | 390 | WP_047796079.1 | hypothetical protein | - |
| ayp1020_RS01630 (AYP1020_0335) | - | 312153..312707 (+) | 555 | WP_047796080.1 | phage major tail protein, TP901-1 family | - |
| ayp1020_RS01635 (AYP1020_0336) | - | 312769..313128 (+) | 360 | WP_047796081.1 | tail assembly chaperone | - |
| ayp1020_RS01640 (AYP1020_0337) | - | 313170..313514 (+) | 345 | WP_047796082.1 | hypothetical protein | - |
| ayp1020_RS01645 (AYP1020_0338) | - | 313532..317515 (+) | 3984 | WP_047796083.1 | tail protein | - |
| ayp1020_RS01650 (AYP1020_0339) | - | 317527..318483 (+) | 957 | WP_047796084.1 | phage tail domain-containing protein | - |
| ayp1020_RS01655 (AYP1020_0340) | - | 318495..319955 (+) | 1461 | WP_047796085.1 | DUF7643 domain-containing protein | - |
| ayp1020_RS01660 (AYP1020_0341) | - | 319958..321844 (+) | 1887 | WP_047796086.1 | M14 family metallopeptidase | - |
| ayp1020_RS01665 (AYP1020_0342) | - | 321857..323044 (+) | 1188 | WP_047796087.1 | BppU family phage baseplate upper protein | - |
| ayp1020_RS01670 (AYP1020_0343) | - | 323058..323480 (+) | 423 | WP_047796088.1 | hypothetical protein | - |
| ayp1020_RS01675 (AYP1020_0344) | - | 323461..323859 (+) | 399 | WP_047796089.1 | hypothetical protein | - |
| ayp1020_RS12625 (AYP1020_0345) | - | 323913..324044 (+) | 132 | WP_023350514.1 | hypothetical protein | - |
| ayp1020_RS01680 (AYP1020_0346) | - | 324265..324882 (+) | 618 | WP_047796090.1 | AP2 domain-containing protein | - |
| ayp1020_RS01685 (AYP1020_0347) | - | 325022..326767 (+) | 1746 | WP_229957090.1 | glucosaminidase domain-containing protein | - |
| ayp1020_RS01690 (AYP1020_0348) | - | 326820..328478 (+) | 1659 | WP_047796092.1 | BppU family phage baseplate upper protein | - |
| ayp1020_RS01695 (AYP1020_0349) | - | 328490..328828 (+) | 339 | WP_047796093.1 | hypothetical protein | - |
| ayp1020_RS01700 (AYP1020_0350) | - | 328821..328967 (+) | 147 | WP_047796094.1 | XkdX family protein | - |
| ayp1020_RS01705 (AYP1020_0351) | - | 329008..329523 (+) | 516 | WP_047796095.1 | hypothetical protein | - |
| ayp1020_RS01710 (AYP1020_0352) | - | 329523..330056 (+) | 534 | WP_047796096.1 | hypothetical protein | - |
| ayp1020_RS01715 (AYP1020_0353) | - | 330100..330510 (+) | 411 | WP_047796097.1 | phage holin | - |
| ayp1020_RS01720 (AYP1020_0354) | - | 330485..331948 (+) | 1464 | WP_047796098.1 | SH3 domain-containing protein | - |
| ayp1020_RS12485 (AYP1020_0355) | - | 332926..333123 (+) | 198 | WP_023350503.1 | hypothetical protein | - |
| ayp1020_RS01725 (AYP1020_0356) | - | 333836..334297 (-) | 462 | WP_053035556.1 | Ltp family lipoprotein | - |
| ayp1020_RS01730 (AYP1020_0357) | - | 334969..335640 (-) | 672 | WP_047796099.1 | Ltp family lipoprotein | - |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22695.79 Da Isoelectric Point: 9.5768
>NTDB_id=121503 ayp1020_RS01400 WP_002433165.1 286200..286775(+) (comK/comK1) [Staphylococcus capitis subsp. capitis strain AYP1020]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDSIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDSIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK
Nucleotide
Download Length: 576 bp
>NTDB_id=121503 ayp1020_RS01400 WP_002433165.1 286200..286775(+) (comK/comK1) [Staphylococcus capitis subsp. capitis strain AYP1020]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAGAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGTAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAGCATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAGAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGTAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAGCATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.596 |
98.429 |
0.754 |
| comK/comK1 | Staphylococcus aureus N315 |
76.596 |
98.429 |
0.754 |